DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment NimA and NimC1

DIOPT Version :9

Sequence 1:NP_001285918.1 Gene:NimA / 318930 FlyBaseID:FBgn0261514 Length:565 Species:Drosophila melanogaster
Sequence 2:NP_001260453.1 Gene:NimC1 / 34816 FlyBaseID:FBgn0259896 Length:622 Species:Drosophila melanogaster


Alignment Length:338 Identity:73/338 - (21%)
Similarity:110/338 - (32%) Gaps:126/338 - (37%)


- Green bases have known domain annotations that are detailed below.


  Fly    91 KTEMREVMRVQKLNKTRTVRFCCQGYEGNLSDSQATCKPICRGGCGR-GSCVMPDICSCEEGYIG 154
            :|..|.|||..          ||:||||::.:    |||:||..|.: |.|..|:.|||..||  
  Fly    73 ETAYRTVMRPS----------CCEGYEGSVEN----CKPVCRQQCPQHGFCSSPNTCSCNAGY-- 121

  Fly   155 KHCTQRCDHDRWGLDCKNLCQ--CQNGAACDNKSGLCHCIAGWTG--------QFCELPCPQGTY 209
                       .|:||..:|.  |.....|| :.|:|.|..|:..        ..||..|...::
  Fly   122 -----------GGIDCHPVCPTVCGKNEFCD-RPGVCSCQNGYKRTSPSDNCLPVCEKECGHHSF 174

  Fly   210 GIMCRK--ACDCD---EK-----------------PCNP-------QTGACIQQDQPLQLNVSHV 245
               |.:  .|:|:   ||                 .|:|       |...|::..          
  Fly   175 ---CSEPGKCECEPGYEKVGNGTVFPDGYKNNSNGNCSPICPKDCGQNSRCVRPG---------- 226

  Fly   246 IVETVN---------------STLEKMGIIPRPTTPVPLPEVIV---IKQP---TSNENAQHSPK 289
            :.|..|               ||..:.|:...|...|..|..::   :.||   ..::||.    
  Fly   227 VCECENGYAGDDGGTNCRPVCSTCPENGLCLSPGVCVCKPGYVMRNDLCQPHCEKCSDNAH---- 287

  Fly   290 IIVHQSSSDLLENLHTAAAAGVPTPEVIHVITNGITSPQEHLAGFVG------------------ 336
             .|..:..:......::.|.....|:.....|||.....|.....:|                  
  Fly   288 -CVAPNQCECFPGYESSGADKKCVPKCSKGCTNGFCFAPETCVCSIGYQMGPNQVCEPKCSLNCV 351

  Fly   337 -GEANSSQTATAD 348
             |:..|.:|.|.|
  Fly   352 HGKCTSPETCTCD 364

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
NimANP_001285918.1 EMI 52..116 CDD:284877 7/24 (29%)
EGF_2 170..200 CDD:285248 9/39 (23%)
NimC1NP_001260453.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1218
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.