DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment NimA and NimB1

DIOPT Version :9

Sequence 1:NP_001285918.1 Gene:NimA / 318930 FlyBaseID:FBgn0261514 Length:565 Species:Drosophila melanogaster
Sequence 2:NP_001260452.1 Gene:NimB1 / 34813 FlyBaseID:FBgn0027929 Length:403 Species:Drosophila melanogaster


Alignment Length:346 Identity:73/346 - (21%)
Similarity:110/346 - (31%) Gaps:125/346 - (36%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 LFGKLLLLLAMVLPLGSGQNSTLKI-------NTNVKDIEAGVVALPSIQGPGNICIREEPYVEH 63
            |.|...||..:..|:....:||:..       ||...|.|:   ...:.:...::|.||.|.| .
  Fly     7 LAGLTALLTLVAFPVQIKTDSTVSTELYGDIENTEYGDFES---LSQTRERQQHLCHREVPSV-F 67

  Fly    64 VQVPEMQPVR-----------------VRTSSWCMEIPPRCATFKTE---------------MRE 96
            .|.....|||                 .|...:..|..|.|:....:               ..|
  Fly    68 FQTERDSPVRGNGSTIYFHRIEVCCAGYRRDPYANECVPDCSASSPDNCRNGFCRSPGVCECFAE 132

  Fly    97 VMRVQK-----------------LNKT-----------RTVRFC-------CQGYEGNLSDSQAT 126
            .:|.:.                 ||.|           .|.:||       |..:|..::..|..
  Fly   133 FVRNEHGACIHTCPIACQHGRCYLNGTCVCHQNFVLDQETRQFCRPKCSQSCGTHEECVAPGQCD 197

  Fly   127 ------------CKPICRGGCGRGSCVMPDICSCEEGYIGKHCTQRCDHDRWGLDCKN------- 172
                        |:|:|...||.|.||.|:.|.|..|:|.:.....|:.:.: |:|:|       
  Fly   198 CSPGYRRTPDLGCQPVCAPDCGFGKCVAPNQCECFAGFIKRPNWNVCEAECY-LNCENGLCESRY 261

  Fly   173 LCQCQNG-------AAC-----DN---------KSGLCHCIAGWT--GQFCELPCPQ---GTYG- 210
            .|.|:.|       .:|     ||         ..|:|.|..|:.  |..|...|..   |.|| 
  Fly   262 KCHCREGYRYDVNTTSCLPECSDNCGQGNGVCIAPGVCRCFRGYEVHGAECRPKCESRFCGKYGR 326

  Fly   211 IMCRKACDCDEKPCNPQTGAC 231
            .:..:.|.|.|...:.:.|:|
  Fly   327 CVAPEICGCGEGQQHCRNGSC 347

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
NimANP_001285918.1 EMI 52..116 CDD:284877 22/130 (17%)
EGF_2 170..200 CDD:285248 13/59 (22%)
NimB1NP_001260452.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1218
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.