DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment NimA and CG11674

DIOPT Version :9

Sequence 1:NP_001285918.1 Gene:NimA / 318930 FlyBaseID:FBgn0261514 Length:565 Species:Drosophila melanogaster
Sequence 2:NP_572948.1 Gene:CG11674 / 32374 FlyBaseID:FBgn0030551 Length:344 Species:Drosophila melanogaster


Alignment Length:284 Identity:58/284 - (20%)
Similarity:86/284 - (30%) Gaps:108/284 - (38%)


- Green bases have known domain annotations that are detailed below.


  Fly    86 RCATFKTEMREVMRVQKLNKTRTVRFCC----QGYEGNLSDSQATCKP---------ICRGGCGR 137
            :||.|:             :.|.|...|    :|     |..:..|.|         |..|.|  
  Fly    34 QCAQFE-------------RGRCVDMACICTARG-----SGERVPCTPLEERLKLTNIIGGAC-- 78

  Fly   138 GSCVMPDI--------CSCEEGY---------------IGKHC--TQRCDH-DRWGLDCKNLCQC 176
             .|.||:.        |.|.||:               :|..|  .|:|.. ||:.....|.|.|
  Fly    79 -PCPMPNAICHTRWQQCHCSEGHVSSDDRRRCLPAVVPVGGSCEFQQQCQRADRFSSCIGNQCLC 142

  Fly   177 QN--------------------------GAA-CDNKSGLCHCIAGWTGQFCELPCPQGT-YGIMC 213
            .|                          ||: |..|:..|.|...:........|.:|: ||..|
  Fly   143 LNQFEFHEGRCLSVLQSSCLEDKDCGSCGASICLTKTKRCGCSKNFVHNHNMTKCIKGSAYGDTC 207

  Fly   214 RKACDCDEKPCNPQTGA--------CIQQDQPLQLNVSHVIVETVNSTLEKMGIIPRPTTPVPLP 270
            ..:     .||....||        |:.:.......|::.:.:..|..|:.:..:.|.|....:|
  Fly   208 EHS-----SPCKLNLGADGRCLDHLCVCRSTHYPKRVANEVAKDENDDLDAVNNLERITCAPIVP 267

  Fly   271 EVIVIK-------QPTSNENAQHS 287
            ...:.:       ||...|||..|
  Fly   268 FGALCRNDSECRMQPMDQENATAS 291

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
NimANP_001285918.1 EMI 52..116 CDD:284877 6/33 (18%)
EGF_2 170..200 CDD:285248 10/56 (18%)
CG11674NP_572948.1 EB 96..153 CDD:279949 13/56 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1218
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D561378at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.