DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment NimA and Ccbe1

DIOPT Version :9

Sequence 1:NP_001285918.1 Gene:NimA / 318930 FlyBaseID:FBgn0261514 Length:565 Species:Drosophila melanogaster
Sequence 2:NP_848908.1 Gene:Ccbe1 / 320924 MGIID:2445053 Length:408 Species:Mus musculus


Alignment Length:217 Identity:51/217 - (23%)
Similarity:73/217 - (33%) Gaps:70/217 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly    89 TFKTEM----REVMRVQKLNKTR----------TVRF---CCQGYEGNLSD---------SQATC 127
            |::.|.    |||....|:..|:          |..|   ||:||:..|..         :||.|
Mouse    35 TYREEPEDRDREVCSENKITTTKYPCLKSSGELTTCFRKKCCKGYKFVLGQCIPEDYDICAQAPC 99

  Fly   128 KPICRGGCGRGSCVMPDICSCEEGYIGKHCTQRCDHDR-------WGLDCKNLCQCQNGAACD-- 183
            :..|....||      .:|:|..||       |.|.:|       :.||... |...|...|.  
Mouse   100 EQQCTDNFGR------VLCTCYPGY-------RYDRERHQKRERPYCLDIDE-CATSNTTLCAHI 150

  Fly   184 --NKSGL--CHCIAGW----TGQFCELPCPQGTYGIMCRKACDCDEKPCNP-QTGACIQQDQPLQ 239
              |..|.  |.|..|:    .|:.|       |.|.........:||..|. :.|.|....:...
Mouse   151 CINTMGSYHCECREGYILEDDGRTC-------TRGDKYPNDTGHEEKSENEVKAGTCCATCKEFS 208

  Fly   240 LNVSHVIVETVNSTLEKMGIIP 261
                 .:.:||....:||.::|
Mouse   209 -----QMKQTVLQLKQKMALLP 225

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
NimANP_001285918.1 EMI 52..116 CDD:284877 11/43 (26%)
EGF_2 170..200 CDD:285248 9/39 (23%)
Ccbe1NP_848908.1 EGF_CA 135..176 CDD:214542 11/48 (23%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 246..335
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 361..408
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1218
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.