DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment NimA and dkk1b

DIOPT Version :9

Sequence 1:NP_001285918.1 Gene:NimA / 318930 FlyBaseID:FBgn0261514 Length:565 Species:Drosophila melanogaster
Sequence 2:NP_571078.1 Gene:dkk1b / 30197 ZFINID:ZDB-GENE-990708-5 Length:241 Species:Danio rerio


Alignment Length:259 Identity:52/259 - (20%)
Similarity:84/259 - (32%) Gaps:84/259 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly    11 LLLLAMVLPLGSGQNSTLKINTNVKDIEAGVVALPSIQGPGNICIREEPYVEHVQVPEMQPVRVR 75
            |:.:..:...||     ..:|:|...:.:|.........|.               |::.|  :.
Zfish    12 LIFMGCIKVAGS-----TMLNSNAIKVGSGAAGSSHPVSPS---------------PDVSP--LD 54

  Fly    76 TSSWCMEIPPR---CAT--------FKTEMREVMRVQKLNKTRTVR--FCCQGYEGNLSDSQATC 127
            :.::.::.|.:   |.:        |..:.|.|....|..:.|.:|  .||.|            
Zfish    55 SLNFALDTPQQPLICESDEECGGEEFCFQSRGVCLQCKKRRKRCIRDAMCCPG------------ 107

  Fly   128 KPICRGGCGRGSCVM--PDI---CSCEE----------GYIGKHCTQRCDHDRW--GLDCKNLCQ 175
                 ..|..|.|:.  |||   ...||          ..:.|..||....::.  ||:.:|   
Zfish   108 -----NHCSNGVCIPNDPDIIQQLGMEEFVSIAHENSTALMPKVSTQGSPQNQMLKGLEGEN--- 164

  Fly   176 CQNGAACDNKSGLCHCIAGWT---------GQFCELPCPQGTYGIMCRKACDCDE-KPCNPQTG 229
            |...:.|  ...||.....|:         ||.|.....:||:|:...:.|||.| ..|..|.|
Zfish   165 CLRSSDC--AETLCCARHFWSKICKPVLKEGQVCTKHKRKGTHGLEIFQRCDCGEGLSCRTQRG 226

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
NimANP_001285918.1 EMI 52..116 CDD:284877 12/76 (16%)
EGF_2 170..200 CDD:285248 8/38 (21%)
dkk1bNP_571078.1 Dickkopf_N 69..116 CDD:282549 12/63 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1218
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.