DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment NimA and Dkk2

DIOPT Version :9

Sequence 1:NP_001285918.1 Gene:NimA / 318930 FlyBaseID:FBgn0261514 Length:565 Species:Drosophila melanogaster
Sequence 2:NP_001099942.1 Gene:Dkk2 / 295445 RGDID:1308639 Length:259 Species:Rattus norvegicus


Alignment Length:294 Identity:56/294 - (19%)
Similarity:81/294 - (27%) Gaps:139/294 - (47%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MIREKLFGKLLLLLAMVLPLGSGQ--NSTLKINTNVKD----------------IEAGVVALPSI 47
            ::|.|...:.|||||.||.:.|.|  :|..|:| ::|.                :..|:....|.
  Rat     4 LMRVKDSSRCLLLLAAVLMVESSQLSSSRAKLN-SIKSSLGGETPAQAANRSAGMNQGLAFGGSK 67

  Fly    48 QGP----------------GNICIREEPYVEHVQVPEMQPVRVRTSSWCMEIPPRCATFKTEMRE 96
            :|.                |..|  ..|:              :.||.||               
  Rat    68 KGKSLGQAYPCSSDKECEVGRYC--HSPH--------------QGSSACM--------------- 101

  Fly    97 VMRVQKLNKTRTVR--FCCQGYEGNLSDSQATCKPICRG-------------------------- 133
               |.:..|.|..|  .||.|...|    ...|.|:...                          
  Rat   102 ---VCRRKKKRCHRDGMCCPGTRCN----NGICIPVTESILTPHIPALDGTRHRDRNHGHYSNHD 159

  Fly   134 ----GCGRGSCVMPDICSCEEGYIGKHCTQRCDHDRWGLDCKNLCQCQNGAACDNKSGLCHCIAG 194
                ..||....||.|    :|:.|..|.:..|             |.:|..|....        
  Rat   160 LGWQNLGRPHSKMPHI----KGHEGDPCLRSSD-------------CIDGFCCARHF-------- 199

  Fly   195 WT---------GQFCELPCPQGTYGIMCRKACDC 219
            ||         |:.|.....:|::|:...:.|||
  Rat   200 WTKICKPVLHQGEVCTKQRKKGSHGLEIFQRCDC 233

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
NimANP_001285918.1 EMI 52..116 CDD:284877 12/65 (18%)
EGF_2 170..200 CDD:285248 6/38 (16%)
Dkk2NP_001099942.1 Dickkopf_N 78..128 CDD:398399 15/87 (17%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1218
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.