DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment NimA and Dkk1

DIOPT Version :9

Sequence 1:NP_001285918.1 Gene:NimA / 318930 FlyBaseID:FBgn0261514 Length:565 Species:Drosophila melanogaster
Sequence 2:NP_001099820.1 Gene:Dkk1 / 293897 RGDID:1307313 Length:270 Species:Rattus norvegicus


Alignment Length:285 Identity:66/285 - (23%)
Similarity:102/285 - (35%) Gaps:82/285 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 LLLLLAMVL----PLG-SGQNSTLKINTN-VKDIEAGVVALPSIQG----PGNICIREEPYV--- 61
            |::|..|.|    ||| |...:::.||:| :|::.      |.:.|    ||: .:...|.|   
  Rat    13 LVVLSTMALCSLPPLGVSATLNSVLINSNAIKNLP------PPLGGAGGQPGS-AVSVAPGVLYE 70

  Fly    62 ---EHVQVPEMQPV------RVRTSSWCMEIPPRCATFKTEMREVMRVQKLNKTRTVR--FCCQG 115
               ::..:...||.      ...|..:|.. |.|.|.....::..:..:|..| |.:|  .||.|
  Rat    71 GGNKYQTLDNYQPYPCAEDEECGTDEYCSS-PSRGAAGVGGVQICLACRKRRK-RCMRHAMCCPG 133

  Fly   116 YEGNLSDSQATCKPICRGGCGRGSCVMPDICSCEEGYIGKHCTQRCDHD---------RWGLDCK 171
                             ..|..|.|:..|......|.|.:...:...:|         |..|..|
  Rat   134 -----------------NYCKNGICMPSDHSHLPRGEIEEGIIENLGNDHGAGDGYPRRTTLTSK 181

  Fly   172 NL-CQCQNGAAC----DNKSGLCHCIAGWT---------GQFCELPCPQGTYGIMCRKACDCDEK 222
            .. .:.|.|:.|    |..:|||.....|:         ||.|.....:|::|:...:.|.|.| 
  Rat   182 IYHTKGQEGSVCLRSSDCATGLCCARHFWSKICKPVLKEGQVCTKHRRKGSHGLEIFQRCYCGE- 245

  Fly   223 PCNPQTG-AC-IQQDQPLQLNVSHV 245
                  | || ||:|.....|.|.:
  Rat   246 ------GLACRIQKDHHQTSNSSRL 264

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
NimANP_001285918.1 EMI 52..116 CDD:284877 15/77 (19%)
EGF_2 170..200 CDD:285248 11/43 (26%)
Dkk1NP_001099820.1 Dickkopf_N 86..142 CDD:398399 14/74 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1218
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.