DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment NimA and Megf10

DIOPT Version :9

Sequence 1:NP_001285918.1 Gene:NimA / 318930 FlyBaseID:FBgn0261514 Length:565 Species:Drosophila melanogaster
Sequence 2:NP_001094127.1 Gene:Megf10 / 291445 RGDID:735084 Length:1145 Species:Rattus norvegicus


Alignment Length:189 Identity:65/189 - (34%)
Similarity:89/189 - (47%) Gaps:8/189 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly    46 SIQGPGNICIREEPYVEHVQVPEMQPVRVRTSSWCMEIPP--RCATFKTEMREVMRVQKLNKTRT 108
            :::.| |:|...|.|...||.....|......:.|.:|..  :|...:...|...|..:....|.
  Rat    27 NLEDP-NVCSHWESYSVTVQESYPHPFDQIYYTSCTDILNWFKCTRHRVSYRTAYRHGEKTMYRR 90

  Fly   109 VRFCCQGYEGNLSDSQATCKPICRGGCGRGSCVMPDICSCEEGYIGKHCTQRCDHDRWGLDCKNL 173
            ...||.|:    .:|:..|.|.|...|..|.|:.|:.|.||.|:.|.:|:..||.|.||..|.:.
  Rat    91 KSQCCPGF----YESRDVCVPHCADKCVHGRCIAPNTCQCEPGWGGTNCSSACDGDHWGPHCSSR 151

  Fly   174 CQCQNGAACDNKSGLCHCIAGWTGQFCELPCPQGTYGIMCRKACDCDE-KPCNPQTGAC 231
            |||:|.|.|:..:|.|||.||:.|..||..|.|||||..|.:.|.|.. ..|:..||.|
  Rat   152 CQCKNRALCNPITGACHCAAGYRGWRCEDRCEQGTYGNDCHQRCQCQNGATCDHITGEC 210

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
NimANP_001285918.1 EMI 52..116 CDD:284877 15/65 (23%)
EGF_2 170..200 CDD:285248 14/29 (48%)
Megf10NP_001094127.1 EMI 32..99 CDD:400092 16/70 (23%)
EGF_Lam 281..318 CDD:214543
EGF_CA 542..587 CDD:419698
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1218
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D561378at2759
OrthoFinder 1 1.000 - - FOG0001631
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
54.820

Return to query results.
Submit another query.