DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment NimA and DKK3

DIOPT Version :9

Sequence 1:NP_001285918.1 Gene:NimA / 318930 FlyBaseID:FBgn0261514 Length:565 Species:Drosophila melanogaster
Sequence 2:NP_001317149.1 Gene:DKK3 / 27122 HGNCID:2893 Length:364 Species:Homo sapiens


Alignment Length:422 Identity:82/422 - (19%)
Similarity:120/422 - (28%) Gaps:161/422 - (38%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 LLLLLAMVLPLGSGQNSTLKINTNVKDIEAGVVALPSIQGPGNICIREEPYVEHVQVPEMQPVRV 74
            |.||||..:|.......|.        ..|.|...|::..|.......|.:.|..::.|....::
Human     9 LCLLLAAAVPTAPAPAPTA--------TSAPVKPGPALSYPQEEATLNEMFREVEELMEDTQHKL 65

  Fly    75 RTSSWCMEIPPRCATFKTEM---------------------------REVMRVQKLNKT------ 106
            |::...||.....|...:|:                           ||:.::.. |:|      
Human    66 RSAVEEMEAEEAAAKASSEVNLANLPPSYHNETNTDTKVGNNTIHVHREIHKITN-NQTGQMVFS 129

  Fly   107 RTVRFCCQGYEGNLSDS------------------QATCKPICRGGCGRGSCVMPDICSCEEGYI 153
            .||.......||..|..                  |.||:| |||  .|..|.....|..::..:
Human   130 ETVITSVGDEEGRRSHECIIDEDCGPSMYCQFASFQYTCQP-CRG--QRMLCTRDSECCGDQLCV 191

  Fly   154 GKHCTQRCDHDRWGLDCKNLCQCQNGAACDNKSG--------------LCHCIAG-------W-- 195
            ..|||:.......|..|.|...||.|..|..:.|              |||..|.       |  
Human   192 WGHCTKMATRGSNGTICDNQRDCQPGLCCAFQRGLLFPVCTPLPVEGELCHDPASRLLDLITWEL 256

  Fly   196 --TGQFCELPCPQGTYGIMCRKACDCDEKPCNPQTGACIQQDQPLQLNVSHVIVETVNSTLEKMG 258
              .|.....||..   |::|                      ||.:|           ..||. |
Human   257 EPDGALDRCPCAS---GLLC----------------------QPHRL-----------PRLEP-G 284

  Fly   259 IIPRPTTPVPLPEVIVIKQPTSNENAQHSPKII-----------------VHQSSSDLLENLHTA 306
            .:|    .:|...::.:.:||...:.....:|:                 |.|...||..:|   
Human   285 FVP----SLPSHSLVYVCKPTFVGSRDQDGEILLPREVPDEYEVGSFMEEVRQELEDLERSL--- 342

  Fly   307 AAAGVPTPEVIHVITNGITSPQEHLAGFVGGE 338
                  |.|:      .:..|....|..:|||
Human   343 ------TEEM------ALREPAAAAAALLGGE 362

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
NimANP_001285918.1 EMI 52..116 CDD:284877 14/96 (15%)
EGF_2 170..200 CDD:285248 13/54 (24%)
DKK3NP_001317149.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1218
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.