DRSC - DRSC Integrative Ortholog Prediction Tool

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits

Protein Alignment NimA and DKK4

DIOPT Version :9

Sequence 1:	NP_001285918.1	Gene:	NimA / 318930	FlyBaseID:	FBgn0261514	Length:	565	Species:	Drosophila melanogaster
Sequence 2:	NP_055235.1	Gene:	DKK4 / 27121	HGNCID:	2894	Length:	224	Species:	Homo sapiens

Alignment Length:	122	Identity:	26/122 - (21%)
Similarity:	38/122 - (31%)	Gaps:	48/122 - (39%)

- Green bases have known domain annotations that are detailed below.

  Fly   134 GCGRGS-CVMPDICSCEEGYIGKHCTQRCDHDRWGLDCKNL-CQCQNGAACDNKSGLCHCIAGWT 196
            |..:|| |:....|:..     |.|.|..|...:...|:.| .:||..|.|
Human    34 GARKGSQCLSDTDCNTR-----KFCLQPRDEKPFCATCRGLRRRCQRDAMC-------------- 79

  Fly   197 GQFCELPCPQGTYGIMC----------------RKACDCDEKPCNPQTGACIQQDQP 237
                   ||    |.:|                |:..:.|.......||..:|::||
Human    80 -------CP----GTLCVNDVCTTMEDATPILERQLDEQDGTHAEGTTGHPVQENQP 125

Known Domains:

Indicated by green bases in alignment.

Gene	Sequence	Domain	Region	External ID	Identity
NimA	NP_001285918.1	EMI	52..116	CDD:284877
NimA	NP_001285918.1	EGF_2	170..200	CDD:285248	6/30 (20%)
DKK4	NP_055235.1	Dickkopf_N	41..91	CDD:309719	16/79 (20%)
		DKK-type Cys-1	41..90		16/78 (21%)
		Disordered. /evidence=ECO:0000256\|SAM:MobiDB-lite	109..139		5/17 (29%)
		DKK-type Cys-2	145..218
		Prokineticin	<145..202	CDD:148298
Blue background indicates that the domain is not in the aligned region.

Information from Original Tools:

Tool	Simple Score	Weighted Score	Original Tool Information
Tool	Simple Score	Weighted Score	BLAST Result	Score	Score Type	Cluster ID
Compara	0	0.000	Not matched by this tool.
Domainoid	0	0.000	Not matched by this tool.
eggNOG	1	0.900	-	-		E1_KOG1218
Hieranoid	0	0.000	Not matched by this tool.
Homologene	0	0.000	Not matched by this tool.
Inparanoid	0	0.000	Not matched by this tool.
Isobase	0	0.000	Not matched by this tool.
OMA	0	0.000	Not matched by this tool.
OrthoDB	0	0.000	Not matched by this tool.
OrthoFinder	0	0.000	Not matched by this tool.
OrthoInspector	0	0.000	Not matched by this tool.
orthoMCL	0	0.000	Not matched by this tool.
Panther	0	0.000	Not matched by this tool.
Phylome	0	0.000	Not matched by this tool.
RoundUp	0	0.000	Not matched by this tool.
SonicParanoid	0	0.000	Not matched by this tool.
SwiftOrtho	0	0.000	Not matched by this tool.
TreeFam	0	0.000	Not matched by this tool.
User_Submission	0	0.000	Not matched by this tool.
	1	0.900