DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment NimA and DKK4

DIOPT Version :10

Sequence 1:NP_609691.6 Gene:NimA / 318930 FlyBaseID:FBgn0261514 Length:565 Species:Drosophila melanogaster
Sequence 2:NP_055235.1 Gene:DKK4 / 27121 HGNCID:2894 Length:224 Species:Homo sapiens


Alignment Length:122 Identity:26/122 - (21%)
Similarity:38/122 - (31%) Gaps:48/122 - (39%)


- Green bases have known domain annotations that are detailed below.


  Fly   134 GCGRGS-CVMPDICSCEEGYIGKHCTQRCDHDRWGLDCKNL-CQCQNGAACDNKSGLCHCIAGWT 196
            |..:|| |:....|:..     |.|.|..|...:...|:.| .:||..|.|              
Human    34 GARKGSQCLSDTDCNTR-----KFCLQPRDEKPFCATCRGLRRRCQRDAMC-------------- 79

  Fly   197 GQFCELPCPQGTYGIMC----------------RKACDCDEKPCNPQTGACIQQDQP 237
                   ||    |.:|                |:..:.|.......||..:|::||
Human    80 -------CP----GTLCVNDVCTTMEDATPILERQLDEQDGTHAEGTTGHPVQENQP 125

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
NimANP_609691.6 EMI 51..118 CDD:462204
DKK4NP_055235.1 Dkk4_Cys1 37..91 CDD:438007 18/83 (22%)
DKK-type Cys-1 41..90 16/78 (21%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 109..139 5/17 (29%)
Dkk4_Cys2 128..221 CDD:438001
DKK-type Cys-2 145..218
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.