DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment NimA and NimB2

DIOPT Version :9

Sequence 1:NP_001285918.1 Gene:NimA / 318930 FlyBaseID:FBgn0261514 Length:565 Species:Drosophila melanogaster
Sequence 2:NP_723857.1 Gene:NimB2 / 260645 FlyBaseID:FBgn0028543 Length:421 Species:Drosophila melanogaster


Alignment Length:372 Identity:78/372 - (20%)
Similarity:110/372 - (29%) Gaps:167/372 - (44%)


- Green bases have known domain annotations that are detailed below.


  Fly    13 LLAMVLPLGSGQNSTLKINTNVKDIEAGVVALP------------------SIQGPGNICIREEP 59
            :|..:..||.||..|..|.|  :...:|.:.|.                  |.|...|....::.
  Fly    13 VLLAICSLGQGQFKTAGIKT--RQPPSGNLQLAGNSSESGWRSYNQSSYGWSTQNQSNYAWNQQN 75

  Fly    60 YVEH-----VQVPEMQPVRVRTSSWCMEIPPRCATFKTEMR-EVMRVQKL-------NKTRT--- 108
            :||.     |:....|||         .:||....:...:. ...|||.|       ||||:   
  Fly    76 HVEQGSAGFVRAEVFQPV---------TLPPLYGHYVQPVTPPAHRVQVLDETALFINKTRSAMA 131

  Fly   109 --------------------------------VRFCCQGYE------------------------ 117
                                            ::.||.|||                        
  Fly   132 SGVCYKEVPTASLLRNSRDQFVGNGTTPDMSRIQVCCDGYERNPHIYRRCEPICADDCRNGICTA 196

  Fly   118 --------GNLSDSQATCKPICRGGCGRGSCVMPDICSCEEGY-----IGKHCTQRC-------- 161
                    |::..::..|...|..|||.|.|...:.|.|.|||     ..|:|...|        
  Fly   197 PNTCVCIPGHVRTAEGKCISTCPLGCGNGVCDERNECKCREGYSLEPETRKYCQPECKPGCSFGR 261

  Fly   162 ----------DHDRWGLD--CKNLC-QCQNGAACDNKSGLCHCIAGW---TGQ---FCELPCPQG 207
                      |..|...|  |:.:| .|:||..  ...|.|:|.||:   .|:   .|.:||..|
  Fly   262 CVAPNKCACLDGYRLAADGSCEPVCDSCENGKC--TAPGHCNCNAGYLKLQGRCEPICSIPCKNG 324

  Fly   208 TYGIMC---------------RKACDCDEK---PCNPQTGACIQQDQ 236
                .|               ||:.:|..|   ||  ..|.|:..:|
  Fly   325 ----RCIGPDICECASGFEWDRKSAECLPKCDLPC--LNGVCVGNNQ 365

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
NimANP_001285918.1 EMI 52..116 CDD:284877 19/111 (17%)
EGF_2 170..200 CDD:285248 11/36 (31%)
NimB2NP_723857.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1218
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.