DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment NimA and Megf6

DIOPT Version :9

Sequence 1:NP_001285918.1 Gene:NimA / 318930 FlyBaseID:FBgn0261514 Length:565 Species:Drosophila melanogaster
Sequence 2:NP_001156449.1 Gene:Megf6 / 230971 MGIID:1919351 Length:1572 Species:Mus musculus


Alignment Length:157 Identity:59/157 - (37%)
Similarity:76/157 - (48%) Gaps:24/157 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly   112 CCQGYEGNLSDSQA--------TCKPICRGGCGRGSC-VMPDICSCEEGYIGKHCTQRCDHDRWG 167
            |..|:.| ||..:|        .|...|....|.|:| .:..:|.||.||.|..|.|.|....:|
Mouse   849 CAPGWTG-LSCQRACDSGHWGPDCIHPCNCSAGHGNCDAVSGLCLCEAGYEGPQCEQWCRQGYFG 912

  Fly   168 LDCKNLCQCQNGAACDNKSGLCHCIAGWTGQFCELPCPQGTYGIMCRKACDCDE-KPCNPQTGAC 231
            ..|:..|:|::||.||:.||.|.|.|||.|.|||..||.|.:|:.|..||:|.. .||:..||:|
Mouse   913 PGCEQKCRCEHGATCDHVSGACTCPAGWRGSFCEHACPAGFFGLDCGSACNCSAGAPCDAVTGSC 977

  Fly   232 I-----------QQDQPLQ--LNVSHV 245
            |           |...||.  ||.|.:
Mouse   978 ICPAGRWGPHCAQTCPPLTFGLNCSQI 1004

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
NimANP_001285918.1 EMI 52..116 CDD:284877 1/3 (33%)
EGF_2 170..200 CDD:285248 15/29 (52%)
Megf6NP_001156449.1 EMI 42..111 CDD:284877
FXa_inhibition 126..161 CDD:291342
vWFA <153..201 CDD:294047
vWFA <236..284 CDD:294047
vWFA <283..324 CDD:294047
FXa_inhibition 337..372 CDD:291342
vWFA <370..409 CDD:294047
vWFA <412..451 CDD:294047
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1218
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
21.900

Return to query results.
Submit another query.