DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment NimA and F46B3.15

DIOPT Version :9

Sequence 1:NP_001285918.1 Gene:NimA / 318930 FlyBaseID:FBgn0261514 Length:565 Species:Drosophila melanogaster
Sequence 2:NP_507984.2 Gene:F46B3.15 / 185837 WormBaseID:WBGene00009766 Length:149 Species:Caenorhabditis elegans


Alignment Length:165 Identity:34/165 - (20%)
Similarity:52/165 - (31%) Gaps:58/165 - (35%)


- Green bases have known domain annotations that are detailed below.


  Fly    39 AGVVALPSIQGPGNICIREEPYVEHVQVPEMQPVRVRTSSWCM-EIPPRCATFKTEMREVMRVQK 102
            |.||..| :...|          :|..:.|.:|........|: :.|..|.|.|           
 Worm    18 ASVVLAP-VDSEG----------QHCGIVECRPGYDCVGGKCVKDYPNSCTTIK----------- 60

  Fly   103 LNKTRTVRFCCQGYEGNLSDSQATCKPICRGG--------CGR-GSCVMPDICSCEEGYIGK-HC 157
                     |..||:..:.:.:..|.|:....        |.: .||::.|         || .|
 Worm    61 ---------CQAGYQCTIKNGKGGCYPVSNKSLDLCVFTTCPKMSSCIVVD---------GKAKC 107

  Fly   158 TQRCDHDRWGLDCKNLCQCQNGAACDNKSGLCHCI 192
            ..|..      .| .:.||..|..|..::||..|:
 Worm   108 VPRSP------PC-TIKQCPKGQKCGLRNGLSTCV 135

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
NimANP_001285918.1 EMI 52..116 CDD:284877 9/64 (14%)
EGF_2 170..200 CDD:285248 8/23 (35%)
F46B3.15NP_507984.2 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1218
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.