DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment NimA and lag-2

DIOPT Version :9

Sequence 1:NP_001285918.1 Gene:NimA / 318930 FlyBaseID:FBgn0261514 Length:565 Species:Drosophila melanogaster
Sequence 2:NP_503877.1 Gene:lag-2 / 178755 WormBaseID:WBGene00002246 Length:402 Species:Caenorhabditis elegans


Alignment Length:427 Identity:71/427 - (16%)
Similarity:121/427 - (28%) Gaps:176/427 - (41%)


- Green bases have known domain annotations that are detailed below.


  Fly   112 CCQGYEGNLSDSQATCKPIC---RGGCGRGSCVMPDICSCEEGYIGKHCTQRCDHDRWGLDCKNL 173
            |.:.|.||      .|:..|   .....|..|.......|:.|::|.||.|..|..:        
 Worm   124 CARNYFGN------RCENFCDAHLAKAARKRCDAMGRLRCDIGWMGPHC
GQAVDPRK-------- 174

  Fly   174 CQCQNGAAC--------------DNKSGLCHCIAGWTGQFCELPCPQGTYGIMCRKACDCDEKPC 224
            |.|:|...|              .|:..:|.|..|:||..||:      :|.             
 Worm   175 CSCENDGICVSSMIHPSQPNQTSSNEQLICECTNGFTGTRCEI------FGF------------- 220

  Fly   225 NPQTGACIQQDQPLQLNVSHVIVETVNSTLEKMGIIPRPTTPVPLPEVIVIKQPTSN--ENAQHS 287
                       ...||.                         .|.|:...:|....|  :...:.
 Worm   221 -----------NQFQLT-------------------------APRPDACSVKDACLNGAKCFPNG 249

  Fly   288 PKIIVHQSSSDLLENLHTAAAAGVPTPEVIHVITNGITSPQEHLAGFVGGEANSSQTATADHQSG 352
            ||:....:...:.|....:.....||...|.|.|:|.:|                          
 Worm   250 PKVFCSCAVGFIGEFCEISLTTTTPTTVEITVSTSGYSS-------------------------- 288

  Fly   353 LVVTLVSIMLLLLVAIAVGSLYVYRRYHHKNAAVYNANGTVTTLPANPEVVLTEAAVLGKNFHEP 417
              ...:::.|.::.:|.:| .:.|:....:..|:  |.|.|                        
 Worm   289 --AVYITVALFVIFSIIIG-CFKYKFKPMRQQAL--ARGQV------------------------ 324

  Fly   418 LPEPPVAFAVTPQSNEAQPELYDSPSNNSSIKTPPYAYARKESLYSVVSPKSRKGSLDSHLYDEI 482
             |||                 |..|...|.:..|..:.|:|: ::::      :||:.. :.:|:
 Worm   325 -PEP-----------------YKMPETKSMLIDPEASEAQKK-VFTI------EGSVQK-IDEEV 363

  Fly   483 RYHQQHHHQQHHPRSHQHVQHSTTASQFLPARPQIMP 519
            ||...       ||.::.........:..|..|.:.|
 Worm   364 RYTSA-------PRKYESNNEYAVIQKSTPPPPSLSP 393

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
NimANP_001285918.1 EMI 52..116 CDD:284877 1/3 (33%)
EGF_2 170..200 CDD:285248 10/43 (23%)
lag-2NP_503877.1 DSL 103..166 CDD:128366 11/47 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1218
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.