DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment NimA and ced-1

DIOPT Version :9

Sequence 1:NP_001285918.1 Gene:NimA / 318930 FlyBaseID:FBgn0261514 Length:565 Species:Drosophila melanogaster
Sequence 2:NP_740922.1 Gene:ced-1 / 173064 WormBaseID:WBGene00000415 Length:1111 Species:Caenorhabditis elegans


Alignment Length:151 Identity:55/151 - (36%)
Similarity:74/151 - (49%) Gaps:5/151 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly    86 RCATFKTEMREVMRVQKLNKTRTVRFCCQGYEGNLSDSQATCKPICRGGCGRGSCVMPDICSCEE 150
            :|...|...:...:.|.:.|.:.|:.||.||   .......|.|.|...|.:|.|:.|..|.|:.
 Worm    79 QCTVEKRGQKASYQRQLVKKEKYVKQCCDGY---YQTKDHFCLPDCNPPCKKGKCIEPGKCECDP 140

  Fly   151 GYIGKHCTQRCDHDRWGLDCKNLCQCQNGAACDNKSGLCHCIAGWTGQFCELPCPQGTYGIMCRK 215
            ||.||:|...|....|||.|...|.|:|||.||.:.|.|.|.:|:.|:.||.|||...:|..|.|
 Worm   141 GYGGKYCASSCSVGTWGLGCSKSCDCENGANCDPELGTCICTSGFQGERCEKPCPDNKWGPNCVK 205

  Fly   216 ACDCDE-KPCNPQTGACIQQD 235
            :|.|.. ..||.: |.|:..|
 Worm   206 SCPCQNGGKCNKE-GKCVCSD 225

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
NimANP_001285918.1 EMI 52..116 CDD:284877 7/29 (24%)
EGF_2 170..200 CDD:285248 13/29 (45%)
ced-1NP_740922.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D561378at2759
OrthoFinder 1 1.000 - - FOG0001631
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.920

Return to query results.
Submit another query.