DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment NimA and Dkk3

DIOPT Version :9

Sequence 1:NP_001285918.1 Gene:NimA / 318930 FlyBaseID:FBgn0261514 Length:565 Species:Drosophila melanogaster
Sequence 2:NP_612528.2 Gene:Dkk3 / 171548 RGDID:621846 Length:348 Species:Rattus norvegicus


Alignment Length:321 Identity:67/321 - (20%)
Similarity:89/321 - (27%) Gaps:136/321 - (42%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 LLLLLAMVLPLGSGQNSTLKINTNVKDIEAGVVALPSIQGPG----------NICIRE-EPYVEH 63
            |.:|||.|:|.......|             ....|:..||.          |...|| |..:|.
  Rat     9 LCMLLAAVVPTAPTPAPT-------------ATWTPAEPGPALNYPQEEATLNEMFREVEELMED 60

  Fly    64 VQ------VPEM--QPVRVRTSS--WCMEIPPRCATFKTEM--------------REVMRVQKLN 104
            .|      |.||  :....||||  ....:|   |.:..|.              |||.::....
  Rat    61 TQHKLRSAVEEMEAEEAAARTSSEVTLSSLP---ANYHNETNTETRMENNTAHVHREVHKITNNQ 122

  Fly   105 KTRTV-----------------------------RFCCQGYEGNLSDSQATCKPICRGG---CGR 137
            ..:||                             |:|      ..|..:.||:| ||..   |.|
  Rat   123 SGQTVFSETVITSVEDGEGKKSHECIIDEDCGPTRYC------QFSSFKYTCQP-CRDQQMLCTR 180

  Fly   138 GS-CVMPDICSCEEGYIGKHCTQRCDHDRWGLDCKNLCQCQNGAACDNKSG-------------- 187
            .| |....:|:      ..||||:......|..|.|...||.|..|..:.|              
  Rat   181 DSECCGDQLCA------WGHCTQKATKGSNGTICDNQRDCQPGLCCAFQRGLLFPVCTPLPVEGE 239

  Fly   188 LCH-------CIAGW----TGQFCELPCPQGTYGIMCRKACDCDEKPCNPQTGACIQQDQP 237
            |||       .:..|    .|.....||..|..              |.|.:.:.:...:|
  Rat   240 LCHDPTSQMLDLITWELEPEGALDRCPCASGLL--------------CQPHSHSLVYMCKP 286

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
NimANP_001285918.1 EMI 52..116 CDD:284877 23/117 (20%)
EGF_2 170..200 CDD:285248 12/54 (22%)
Dkk3NP_612528.2 Dickkopf_N 147..196 CDD:282549 14/61 (23%)
Prokineticin <208..273 CDD:148298 15/78 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1218
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.