DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment NimA and Dlk1

DIOPT Version :9

Sequence 1:NP_001285918.1 Gene:NimA / 318930 FlyBaseID:FBgn0261514 Length:565 Species:Drosophila melanogaster
Sequence 2:NP_034182.2 Gene:Dlk1 / 13386 MGIID:94900 Length:385 Species:Mus musculus


Alignment Length:376 Identity:83/376 - (22%)
Similarity:123/376 - (32%) Gaps:133/376 - (35%)


- Green bases have known domain annotations that are detailed below.


  Fly   112 CCQGYEGNLSDSQATCKPICRGGCGRGSCVMPDICSCEEGYIGKHC---TQRC------------ 161
            |..|:||.|.|     |.:...||..|.|..|..|.|::|:.||.|   .:.|            
Mouse    45 CHVGWEGPLCD-----KCVTAPGCVNGVCKEPWQCICKDGWDGKFCEIDVRACTSTPCANNGTCV 104

  Fly   162 DHDRW-----------GLDCK--------NLCQCQNGAACDNKSG-----LCHCIAGWTGQFCEL 202
            |.::.           |.||:        |...||:|.||.:..|     .|.|..|::|.|||:
Mouse   105 DLEKGQYECSCTPGFSGKDCQHKAGPCVINGSPCQHGGACVDDEGQASHASCLCPPGFSGNFCEI 169

  Fly   203 ---------------------------PCPQGTYGIMC-RKACDCDEKPCNPQTGACIQQDQPLQ 239
                                       .||.|.....| |...:|...||. ..|.|:|..|   
Mouse   170 VAATNSCTPNPCENDGVCTDIGGDFRCRCPAGFVDKTCSRPVSNCASGPCQ-NGGTCLQHTQ--- 230

  Fly   240 LNVSHVIVETVNSTLEK---MGIIPRPTTPVPLPEVIVIKQPTSNENAQHSPKIIVHQSSSDLLE 301
              ||.       ..|.|   ||                   ||..:....||..:.|..|...|.
Mouse   231 --VSF-------ECLCKPPFMG-------------------PTCAKKRGASPVQVTHLPSGYGLT 267

  Fly   302 NLHTAAAAGVPTPEVIHVITNGITSPQEHLAGFVGGEANSSQTATADHQSGLVVTLVSIMLLLLV 366
            ...|.....:|           :..|::|:......|.|.|.....:.|: :..|::.::..|:|
Mouse   268 YRLTPGVHELP-----------VQQPEQHILKVSMKELNKSTPLLTEGQA-ICFTILGVLTSLVV 320

  Fly   367 AIAVGSLYVYR--------RYHH-----KNAAV-YNANGTVTTLPANPEVV 403
            ...|..:::.:        ||:|     ||..: ||:...:......||.:
Mouse   321 LGTVAIVFLNKCETWVSNLRYNHMLRKKKNLLLQYNSGEELAVNIIFPEKI 371

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
NimANP_001285918.1 EMI 52..116 CDD:284877 1/3 (33%)
EGF_2 170..200 CDD:285248 12/42 (29%)
Dlk1NP_034182.2 EGF_CA 88..125 CDD:238011 4/36 (11%)
EGF_CA 135..168 CDD:238011 11/32 (34%)
EGF_CA 177..207 CDD:238011 3/29 (10%)
EGF_CA 214..246 CDD:238011 14/63 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167834089
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - LDO PTHR24052
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.