DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment NimA and Dkk1

DIOPT Version :9

Sequence 1:NP_001285918.1 Gene:NimA / 318930 FlyBaseID:FBgn0261514 Length:565 Species:Drosophila melanogaster
Sequence 2:NP_034181.2 Gene:Dkk1 / 13380 MGIID:1329040 Length:272 Species:Mus musculus


Alignment Length:289 Identity:65/289 - (22%)
Similarity:100/289 - (34%) Gaps:85/289 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 KLLLLLAMV----LPLGSGQNSTLK---INTN-VKDIEAGVVALPSIQG----PGNICIREEPYV 61
            :.|.:..|:    ||| .|.::||.   ||:| :|::.      |.:.|    ||: .:...|.|
Mouse    11 RFLAVFTMMALCSLPL-LGASATLNSVLINSNAIKNLP------PPLGGAGGQPGS-AVSVAPGV 67

  Fly    62 ------EHVQVPEMQPVRVRTSSWC-----MEIPPRCATFKTEMREVMRVQKLNKTRTVR--FCC 113
                  ::..:...||........|     ...|.|.|.....::..:..:|..| |.:|  .||
Mouse    68 LYEGGNKYQTLDNYQPYPCAEDEECGSDEYCSSPSRGAAGVGGVQICLACRKRRK-RCMRHAMCC 131

  Fly   114 QGYEGNLSDSQATCKPICRGGCGRGSCVMPDICSCEEGYIGKHCTQRCDHD-----------RWG 167
            .|                 ..|..|.|:..|......|.|.:...:...:|           |..
Mouse   132 PG-----------------NYCKNGICMPSDHSHFPRGEIEESIIENLGNDHNAAAGDGYPRRTT 179

  Fly   168 LDCKNL-CQCQNGAAC----DNKSGLCHCIAGWT---------GQFCELPCPQGTYGIMCRKACD 218
            |..|.. .:.|.|:.|    |..:|||.....|:         ||.|.....:|::|:...:.|.
Mouse   180 LTSKIYHTKGQEGSVCLRSSDCAAGLCCARHFWSKICKPVLKEGQVCTKHKRKGSHGLEIFQRCY 244

  Fly   219 CDEKPCNPQTG-AC-IQQDQPLQLNVSHV 245
            |.|       | || ||:|.....|.|.:
Mouse   245 CGE-------GLACRIQKDHHQASNSSRL 266

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
NimANP_001285918.1 EMI 52..116 CDD:284877 14/76 (18%)
EGF_2 170..200 CDD:285248 11/43 (26%)
Dkk1NP_034181.2 Dickkopf_N 86..142 CDD:282549 13/73 (18%)
DKK-type Cys-1 86..141 13/72 (18%)
DKK-type Cys-2 195..269 22/79 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1218
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.