DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment NimA and Dlk1

DIOPT Version :9

Sequence 1:NP_001285918.1 Gene:NimA / 318930 FlyBaseID:FBgn0261514 Length:565 Species:Drosophila melanogaster
Sequence 2:XP_038967531.1 Gene:Dlk1 / 114587 RGDID:619931 Length:416 Species:Rattus norvegicus


Alignment Length:374 Identity:82/374 - (21%)
Similarity:118/374 - (31%) Gaps:131/374 - (35%)


- Green bases have known domain annotations that are detailed below.


  Fly   112 CCQGYEGNLSDSQATCKPICRGGCGRGSCVMPDICSCEEGYIGKHC------------------- 157
            |..|:||.|.:     |.:...||..|.|..|..|.|:||:.||.|                   
  Rat    78 CEPGWEGPLCE-----KCVTSPGCVNGLCEEPWQCVCKEGWDGKFCEIDIRACTSTPCANNGTCV 137

  Fly   158 -------TQRCDHDRWGLDCK--------NLCQCQNGAACDNKSG-----LCHCIAGWTGQFCEL 202
                   ...|.....|.||:        |...||:|.||.:..|     .|.|..|::|.|||:
  Rat   138 DLEKGQYECSCTPGFSGKDCQHKAGPCVINGSPCQHGGACVDDEGRASHASCLCPPGFSGNFCEI 202

  Fly   203 -------------------------PCPQGTYGIMC-RKACDCDEKPCNPQTGACIQQDQPLQLN 241
                                     .||.|.....| |...:|...|| ...|.|:|..|     
  Rat   203 VTNSCTPNPCENDGVCTDIGGDFRCRCPAGFVDKTCSRPVSNCASGPC-LNGGTCLQHTQ----- 261

  Fly   242 VSHVIVETVNSTLEK---MGIIPRPTTPVPLPEVIVIKQPTSNENAQHSPKIIVHQSSSDLLENL 303
            ||.       ..|.|   ||                   ||..:....||..:.|..|...|...
  Rat   262 VSF-------ECLCKPPFMG-------------------PTCAKKRGTSPVQVTHLPSGYGLTYR 300

  Fly   304 HTAAAAGVPTPEVIHVITNGITSPQEHLAGFVGGEANSSQTATADHQSGLVVTLVSIMLLLLVAI 368
            .|.....:|           :..|:.|:......|.|.|.....:.|: :..|::.::..|:|..
  Rat   301 LTPGVHELP-----------VQQPEHHILKVSMKELNKSAPLLTEGQA-ICFTILGVLTSLVVLG 353

  Fly   369 AVGSLYVYR--------RYHH-----KNAAV-YNANGTVTTLPANPEVV 403
            .|..:::.:        ||:|     ||..: ||:...:......||.:
  Rat   354 TVAIVFLNKCEAWVSNLRYNHMLRKKKNLLLQYNSGEELAVNIIFPEKI 402

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
NimANP_001285918.1 EMI 52..116 CDD:284877 1/3 (33%)
EGF_2 170..200 CDD:285248 12/42 (29%)
Dlk1XP_038967531.1 EGF_CA 121..158 CDD:238011 3/36 (8%)
EGF_CA 168..201 CDD:238011 11/32 (34%)
EGF_CA 208..238 CDD:238011 3/29 (10%)
EGF_CA 245..277 CDD:238011 14/63 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166337630
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - LDO PTHR24052
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.