DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment NimA and pear1

DIOPT Version :9

Sequence 1:NP_001285918.1 Gene:NimA / 318930 FlyBaseID:FBgn0261514 Length:565 Species:Drosophila melanogaster
Sequence 2:XP_017952446.2 Gene:pear1 / 100489801 XenbaseID:XB-GENE-6045593 Length:1087 Species:Xenopus tropicalis


Alignment Length:192 Identity:71/192 - (36%)
Similarity:93/192 - (48%) Gaps:22/192 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    52 NICIREEPYVEHVQVPEMQPVRVRT-----SSW-----CMEIPPRCATFKTEMREVMRVQKLNKT 106
            |:|...|.:...|:....||....:     |||     |   .|:...::|..|.  || ||:..
 Frog    29 NVCSFWESFTLAVKESYTQPYSQLSPDSCDSSWNYFKAC---TPQKILYRTAYRH--RV-KLDYR 87

  Fly   107 RTVRFCCQGYEGNLSDSQATCKPICRGGCGRGSCVMPDICSCEEGYIGKHCTQRCDHDRWGLDCK 171
            |.. :||:||    .:|...|.|.|...|..|.|:.||.|.||.|:.||.|:..|:...||..|.
 Frog    88 RRY-WCCKGY----YESNDICVPRCTQECVHGRCIAPDQCQCEPGWRGKDCSSACEAHVWGPKCN 147

  Fly   172 NLCQCQNGAACDNKSGLCHCIAGWTGQFCELPCPQGTYGIMCRKACDC-DEKPCNPQTGACI 232
            :.|.|||..|||..||.|.|..|:...|||.||..||||..|..:|.| :...|:|:.|||:
 Frog   148 STCPCQNNGACDAASGTCICPPGFRDPFCEKPCDPGTYGGGCSLSCQCKNGAECDPENGACL 209

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
NimANP_001285918.1 EMI 52..116 CDD:284877 20/73 (27%)
EGF_2 170..200 CDD:285248 13/29 (45%)
pear1XP_017952446.2 EMI 29..97 CDD:400092 22/78 (28%)
exchanger_TraA <147..>310 CDD:411343 29/63 (46%)
exchanger_TraA <416..729 CDD:411343
Laminin_EGF 546..586 CDD:395007
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D561378at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR24052
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
33.020

Return to query results.
Submit another query.