DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment NimA and esm1

DIOPT Version :9

Sequence 1:NP_001285918.1 Gene:NimA / 318930 FlyBaseID:FBgn0261514 Length:565 Species:Drosophila melanogaster
Sequence 2:NP_001120192.1 Gene:esm1 / 100145234 XenbaseID:XB-GENE-995257 Length:185 Species:Xenopus tropicalis


Alignment Length:168 Identity:40/168 - (23%)
Similarity:57/168 - (33%) Gaps:50/168 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly   157 CTQRCDHDRWGLDCKNLCQCQNGAACDNKSGLCHCIAGWTGQFCE-------------------- 201
            |..|||.:    |||:..:|:.....|  .|.|...|...|:.|.                    
 Frog    28 CPDRCDSN----DCKSTTRCKRTVLDD--CGCCRVCAAAAGETCYRTVSGMDGVKCGPGLRCQFF 86

  Fly   202 -------------LPCPQGTYGIMCRKACDCDEKPCNPQTGACIQQDQP-LQLNVSHVIVETVNS 252
                         ..||.||||:.||:.|:|....|:..||.|::  .| .||        |...
 Frog    87 TEEDDFGDEFGICRDCPYGTYGMECRRTCNCQSGICDRVTGKCLK--FPFFQL--------TGGK 141

  Fly   253 TLEKMGIIPRPTTPVPLPEVIVIKQPTSNENAQHSPKI 290
            |..|..::|.....:...:....::.|..|...||..|
 Frog   142 TANKQKVLPSSDQDMASGDGHNDREETLKEKNSHSSGI 179

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
NimANP_001285918.1 EMI 52..116 CDD:284877
EGF_2 170..200 CDD:285248 8/29 (28%)
esm1NP_001120192.1 IGFBP 28..83 CDD:365955 14/60 (23%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.