DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Prosbeta5R2 and PBE1

DIOPT Version :9

Sequence 1:NP_001286022.1 Gene:Prosbeta5R2 / 318924 FlyBaseID:FBgn0051742 Length:279 Species:Drosophila melanogaster
Sequence 2:NP_001184978.1 Gene:PBE1 / 837863 AraportID:AT1G13060 Length:298 Species:Arabidopsis thaliana


Alignment Length:283 Identity:109/283 - (38%)
Similarity:158/283 - (55%) Gaps:41/283 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    15 MKSFGYRTSKQTIEEIRVASSNMDNPLAIMAPPYENPRESVKKLNALSEVQID-FDH--GTTTVG 76
            |...|:.:|...::|:   ||         .|.::.||  .|:.:...:...| ..|  ||||:.
plant    12 MPMIGFGSSSDMLDEL---SS---------VPSFDLPR--TKEFDGFQKKAKDMLKHAKGTTTLA 62

  Fly    77 FVYQGGIILCVDSRATSGKLIG------------------------SQSIHKVVQVNQYIMGTTA 117
            |:::||:::..||||:.|..|.                        |||:.|::::|.|::||.|
plant    63 FIFKGGVMVAADSRASMGGYISVSSLKNSSKNMHPFDIVDFGRNTTSQSVKKIIEINPYMLGTMA 127

  Fly   118 GGAADCTYWDRALTRECRLHELRYKERLPVQSAAKYISNVAAEYKGMGLCMGMMLAGWSPEGPSL 182
            ||||||.:|.|.|..:||||||..|.|:.|..|:|.::|:...|:||||.:|.|:|||...||.|
plant   128 GGAADCQFWHRNLGIKCRLHELANKRRISVSGASKLLANMLYSYRGMGLSVGTMIAGWDETGPGL 192

  Fly   183 VYVDSNGLRIHGKLFAVGSGAPNALGILDSDYRLDLSDNEAYDLAFLAVYHATMTDIFSGGVVRL 247
            .|||:.|.|:.|..|:||||:|.|.|:|||.|:.|:|..||.:||..::||||..|..||||..:
plant   193 YYVDNEGGRLKGDRFSVGSGSPYAYGVLDSGYKYDMSVEEASELARRSIYHATFRDGASGGVASV 257

  Fly   248 YHMDQGNWRNVANKDCQELHEQY 270
            ||:....|..::..|..|||..|
plant   258 YHVGPEGWTKLSGDDVGELHYHY 280

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Prosbeta5R2NP_001286022.1 PTZ00488 46..279 CDD:185666 103/252 (41%)
proteasome_beta_type_5 72..259 CDD:239730 91/210 (43%)
PBE1NP_001184978.1 20S_bact_beta 57..276 CDD:163402 93/218 (43%)
proteasome_beta_type_5 58..269 CDD:239730 91/210 (43%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0638
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 274 1.000 Inparanoid score I897
OMA 1 1.010 - - QHG53702
OrthoDB 1 1.010 - - D929961at2759
OrthoFinder 1 1.000 - - FOG0001305
OrthoInspector 1 1.000 - - mtm956
orthoMCL 1 0.900 - - OOG6_100897
Panther 1 1.100 - - O PTHR11599
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X647
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
1211.840

Return to query results.
Submit another query.