DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Prosbeta5R2 and AT3G26340

DIOPT Version :9

Sequence 1:NP_001286022.1 Gene:Prosbeta5R2 / 318924 FlyBaseID:FBgn0051742 Length:279 Species:Drosophila melanogaster
Sequence 2:NP_189265.1 Gene:AT3G26340 / 822238 AraportID:AT3G26340 Length:273 Species:Arabidopsis thaliana


Alignment Length:239 Identity:103/239 - (43%)
Similarity:145/239 - (60%) Gaps:25/239 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    45 APPYENPRESVKKLNALSEVQIDFD-------------HGTTTVGFVYQGGIILCVDSRATSGKL 96
            ||.::.||.:            |||             .||||:.|:::.|:::..||||:.|..
plant    30 APSFDLPRTT------------DFDGFQKKAVEMVKPAKGTTTLAFIFKEGVMVAADSRASMGGY 82

  Fly    97 IGSQSIHKVVQVNQYIMGTTAGGAADCTYWDRALTRECRLHELRYKERLPVQSAAKYISNVAAEY 161
            |.|||:.|::::|.|::||.|||||||.:|.|.|..:||||||..|.|:.|..|:|.::|:...|
plant    83 ISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLGIKCRLHELANKRRISVSGASKLLANMLYSY 147

  Fly   162 KGMGLCMGMMLAGWSPEGPSLVYVDSNGLRIHGKLFAVGSGAPNALGILDSDYRLDLSDNEAYDL 226
            :||||.:|.|:|||...||.|.|||:.|.|:.|..|:||||:|.|.|:|||.|:.|:|..||.:|
plant   148 RGMGLSVGTMIAGWDETGPGLYYVDNEGGRLKGDRFSVGSGSPYAYGVLDSGYKFDMSVEEASEL 212

  Fly   227 AFLAVYHATMTDIFSGGVVRLYHMDQGNWRNVANKDCQELHEQY 270
            |..::||||..|..||||..:||:....|..::..|..|||..|
plant   213 ARRSIYHATFRDGASGGVASVYHVGPQGWTKLSGDDVGELHYHY 256

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Prosbeta5R2NP_001286022.1 PTZ00488 46..279 CDD:185666 102/238 (43%)
proteasome_beta_type_5 72..259 CDD:239730 90/186 (48%)
AT3G26340NP_189265.1 proteasome_beta_type_5 58..245 CDD:239730 90/186 (48%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0638
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 274 1.000 Inparanoid score I897
OMA 1 1.010 - - QHG53702
OrthoDB 1 1.010 - - D929961at2759
OrthoFinder 1 1.000 - - FOG0001305
OrthoInspector 1 1.000 - - mtm956
orthoMCL 1 0.900 - - OOG6_100897
Panther 1 1.100 - - O PTHR11599
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X647
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
1211.840

Return to query results.
Submit another query.