DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Prosbeta5R2 and psmb13a

DIOPT Version :9

Sequence 1:NP_001286022.1 Gene:Prosbeta5R2 / 318924 FlyBaseID:FBgn0051742 Length:279 Species:Drosophila melanogaster
Sequence 2:NP_571752.2 Gene:psmb13a / 64280 ZFINID:ZDB-GENE-001208-2 Length:281 Species:Danio rerio


Alignment Length:206 Identity:55/206 - (26%)
Similarity:90/206 - (43%) Gaps:9/206 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly    48 YENPRESVKKLNALSEVQID----FDHGTTTVGFVYQGGIILCVDSRATSGKLIGSQSIHKV--V 106
            :||...::...|...|.:|.    ...|||..|.|::.|::|..|:||||.:::..:...|:  :
Zfish    17 FENATRNIVLENGAEEGKIKPPKALKTGTTIAGVVFKDGVVLGADTRATSDEVVADKMCAKIHYI 81

  Fly   107 QVNQYIMGTTAGGAADCTYWDRALTRECRLHELRYKERLPVQSAAKYISNVAAEYKGMGLCMGMM 171
            ..|.|..|  ||.|||.......|:....:..:.......|..|...|.::...|.|| :...::
Zfish    82 APNIYCCG--AGTAADTEKTTDMLSSNLTIFSMNSGRNPRVVMAVNIIQDMLFRYHGM-IGANLI 143

  Fly   172 LAGWSPEGPSLVYVDSNGLRIHGKLFAVGSGAPNALGILDSDYRLDLSDNEAYDLAFLAVYHATM 236
            |.|....|..|..|...|........|:|||...|:|||:..:::::...:|..|...|:....|
Zfish   144 LGGVDCTGSHLYTVGPYGSMDKVPYLAMGSGDLAAMGILEDRFKVNMDLEQAKALVSDAIQAGIM 208

  Fly   237 TDIFSGGVVRL 247
            .|:.||..:.|
Zfish   209 CDLGSGNNIDL 219

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Prosbeta5R2NP_001286022.1 PTZ00488 46..279 CDD:185666 55/206 (27%)
proteasome_beta_type_5 72..259 CDD:239730 49/178 (28%)
psmb13aNP_571752.2 proteasome_beta_type_7 45..233 CDD:239732 49/178 (28%)
Pr_beta_C 241..272 CDD:315191
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0638
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.