DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Prosbeta5R2 and PSMB10

DIOPT Version :9

Sequence 1:NP_001286022.1 Gene:Prosbeta5R2 / 318924 FlyBaseID:FBgn0051742 Length:279 Species:Drosophila melanogaster
Sequence 2:NP_002792.1 Gene:PSMB10 / 5699 HGNCID:9538 Length:273 Species:Homo sapiens


Alignment Length:176 Identity:51/176 - (28%)
Similarity:81/176 - (46%) Gaps:3/176 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly    71 GTTTVGFVYQGGIILCVDSRATSGKLIGSQSIHKVVQVNQYIMGTTAGGAADCTYWDRALTRECR 135
            |||..|.|:|.|:||..|:|||:..::..:|..|:..:...|....||.|||.....|.:..:..
Human    39 GTTIAGLVFQDGVILGADTRATNDSVVADKSCEKIHFIAPKIYCCGAGVAADAEMTTRMVASKME 103

  Fly   136 LHELRYKERLPVQSAAKYISNVAAEYKG-MGLCMGMMLAGWSPEGPSLVYVDSNGLRIHGKLFAV 199
            ||.|.......|.:..:.:......|:| :|  ..:::.|....||.|..|..:|........|:
Human   104 LHALSTGREPRVATVTRILRQTLFRYQGHVG--ASLIVGGVDLTGPQLYGVHPHGSYSRLPFTAL 166

  Fly   200 GSGAPNALGILDSDYRLDLSDNEAYDLAFLAVYHATMTDIFSGGVV 245
            |||...||.:|:..::.:::...|..|...||....:.|:.|||.|
Human   167 GSGQDAALAVLEDRFQPNMTLEAAQGLLVEAVTAGILGDLGSGGNV 212

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Prosbeta5R2NP_001286022.1 PTZ00488 46..279 CDD:185666 51/176 (29%)
proteasome_beta_type_5 72..259 CDD:239730 50/175 (29%)
PSMB10NP_002792.1 proteasome_beta_type_7 40..227 CDD:239732 50/175 (29%)
Pr_beta_C 232..267 CDD:403609
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0638
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.