DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Prosbeta5R2 and PSMB5

DIOPT Version :9

Sequence 1:NP_001286022.1 Gene:Prosbeta5R2 / 318924 FlyBaseID:FBgn0051742 Length:279 Species:Drosophila melanogaster
Sequence 2:NP_002788.1 Gene:PSMB5 / 5693 HGNCID:9542 Length:263 Species:Homo sapiens


Alignment Length:244 Identity:112/244 - (45%)
Similarity:160/244 - (65%) Gaps:14/244 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly    36 NMDNPLAIMAPPYENPRESVKKLNALSEVQIDFDHGTTTVGFVYQGGIILCVDSRATSGKLIGSQ 100
            ::.:.|::.||.:..|.|.          .|:..|||||:.|.::.|:|:..|||||:|..|.||
Human    34 SLSDGLSLAAPGWGVPEEP----------GIEMLHGTTTLAFKFRHGVIVAADSRATAGAYIASQ 88

  Fly   101 SIHKVVQVNQYIMGTTAGGAADCTYWDRALTRECRLHELRYKERLPVQSAAKYISNVAAEYKGMG 165
            ::.||:::|.|::||.|||||||::|:|.|.|:||::|||.|||:.|.:|:|.::|:..:|||||
Human    89 TVKKVIEINPYLLGTMAGGAADCSFWERLLARQCRIYELRNKERISVAAASKLLANMVYQYKGMG 153

  Fly   166 LCMGMMLAGWSPEGPSLVYVDSNGLRIHGKLFAVGSGAPNALGILDSDYRLDLSDNEAYDLAFLA 230
            |.||.|:.||...||.|.||||.|.||.|..|:||||:..|.|::|..|..||...:|||||..|
Human   154 LSMGTMICGWDKRGPGLYYVDSEGNRISGATFSVGSGSVYAYGVMDRGYSYDLEVEQAYDLARRA 218

  Fly   231 VYHATMTDIFSGGVVRLYHMDQGNWRNVANKDCQELHEQYSGVGNQQTP 279
            :|.||..|.:|||.|.|||:.:..|..|::.:..:|||:|||    .||
Human   219 IYQATYRDAYSGGAVNLYHVREDGWIRVSSDNVADLHEKYSG----STP 263

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Prosbeta5R2NP_001286022.1 PTZ00488 46..279 CDD:185666 108/232 (47%)
proteasome_beta_type_5 72..259 CDD:239730 95/186 (51%)
PSMB5NP_002788.1 proteasome_beta_type_5 60..247 CDD:239730 95/186 (51%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0638
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 - 0 Normalized mean entropy S454
OMA 1 1.010 - - QHG53702
OrthoDB 1 1.010 - - D396507at33208
OrthoFinder 1 1.000 - - FOG0001305
OrthoInspector 1 1.000 - - mtm8519
orthoMCL 1 0.900 - - OOG6_100897
Panther 1 1.100 - - O PTHR11599
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X647
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
User_Submission 00.000 Not matched by this tool.
1211.740

Return to query results.
Submit another query.