DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Prosbeta5R2 and PSMA4

DIOPT Version :9

Sequence 1:NP_001286022.1 Gene:Prosbeta5R2 / 318924 FlyBaseID:FBgn0051742 Length:279 Species:Drosophila melanogaster
Sequence 2:NP_001096137.1 Gene:PSMA4 / 5685 HGNCID:9533 Length:261 Species:Homo sapiens


Alignment Length:237 Identity:53/237 - (22%)
Similarity:97/237 - (40%) Gaps:61/237 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly    70 HGTTTVGFVYQGGIILCVDSRATSGKLIGSQSIH----------KVVQVNQYIMGTTAGGAADCT 124
            |..|.:|.:...|::|..:.|          :||          |:.::|:.:..:.||..:|. 
Human    30 HAGTCLGILANDGVLLAAERR----------NIHKLLDEVFFSEKIYKLNEDMACSVAGITSDA- 83

  Fly   125 YWDRALTRECRL----HELRYKERLPVQSAAKYISNVAAEYKGMGLCMGMMLAGWSPEGPSLVYV 185
               ..||.|.||    :.|:|:|.:|.:.....:.::...|...|        |..|.|.||:|:
Human    84 ---NVLTNELRLIAQRYLLQYQEPIPCEQLVTALCDIKQAYTQFG--------GKRPFGVSLLYI 137

  Fly   186 -------------DSNGLRIHGKLFAVGSGAPNALGILDSDYRL-DLSDNEAYDLAFLAVYHATM 236
                         |.:|.....|...:|:.:..|:.:|..||:. :::...|..|| :.|.:.||
Human   138 GWDKHYGFQLYQSDPSGNYGGWKATCIGNNSAAAVSMLKQDYKEGEMTLKSALALA-IKVLNKTM 201

  Fly   237 TDI--FSGGVVRLYHMDQGNWRNV----ANKDCQEL---HEQ 269
             |:  .|...|.:..:.:.|.:.|    ..|:.::|   ||:
Human   202 -DVSKLSAEKVEIATLTRENGKTVIRVLKQKEVEQLIKKHEE 242

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Prosbeta5R2NP_001286022.1 PTZ00488 46..279 CDD:185666 53/237 (22%)
proteasome_beta_type_5 72..259 CDD:239730 48/220 (22%)
PSMA4NP_001096137.1 proteasome_alpha_type_4 3..216 CDD:239721 47/209 (22%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 240..261 2/3 (67%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0638
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.