DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Prosbeta5R2 and psma3

DIOPT Version :9

Sequence 1:NP_001286022.1 Gene:Prosbeta5R2 / 318924 FlyBaseID:FBgn0051742 Length:279 Species:Drosophila melanogaster
Sequence 2:NP_001025358.1 Gene:psma3 / 564370 ZFINID:ZDB-GENE-050913-120 Length:255 Species:Danio rerio


Alignment Length:230 Identity:42/230 - (18%)
Similarity:87/230 - (37%) Gaps:35/230 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    65 QIDF-----DHGTTTVGFVYQGGIILCVDSRATSGKLIGSQSIHKVVQVNQYIMGTTAGGAADCT 124
            |:::     ::.:|.:|...:.|::..|:....| ||....|..::..:::::....||..||..
Zfish    23 QVEYAMKAVENSSTAIGIRCKDGVVFGVEKLVLS-KLYEEGSNKRIFNIDRHVGMAVAGLLADAR 86

  Fly   125 YWDRALTRECRLHELRYKERLPVQSAAKYISNVAAEY------KGMGLCMGMMLAGWSPEGPSLV 183
            ........|.......|...:|::..|..::.....|      :..| |..::.:....:||.|.
Zfish    87 SLSEVAREEASSFRSNYGHDIPLKHLADRVAMYVHAYTLYSAVRPFG-CSFILGSYDEDDGPQLY 150

  Fly   184 YVDSNGLRIHGKLFAVGSGAPNALGILDSDYRLDLSDNEAYDLA-----FLAVYHATMTD----- 238
            .||.:|:.......|:|.....|...::   :|.:.|....:|.     .:.:.|..:.|     
Zfish   151 MVDPSGIAYGYWGCAIGKAKQAAKTEIE---KLQMKDMTCRELVKEVAKIIYIVHDEVKDKAFEL 212

  Fly   239 --IFSGGVVRLYHMDQGNWRNVANKDCQELHEQYS 271
              .:.|.|.:..|       .:..||.:|..|:|:
Zfish   213 ELSWVGEVTKGRH-------ELVPKDVKEEAEKYA 240

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Prosbeta5R2NP_001286022.1 PTZ00488 46..279 CDD:185666 42/230 (18%)
proteasome_beta_type_5 72..259 CDD:239730 36/204 (18%)
psma3NP_001025358.1 proteasome_alpha_type_3 5..217 CDD:239720 34/198 (17%)
PRE1 6..241 CDD:223711 42/230 (18%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0638
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.