DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Prosbeta5R2 and psma6b

DIOPT Version :9

Sequence 1:NP_001286022.1 Gene:Prosbeta5R2 / 318924 FlyBaseID:FBgn0051742 Length:279 Species:Drosophila melanogaster
Sequence 2:NP_001002589.1 Gene:psma6b / 436862 ZFINID:ZDB-GENE-040718-329 Length:246 Species:Danio rerio


Alignment Length:216 Identity:45/216 - (20%)
Similarity:81/216 - (37%) Gaps:39/216 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    31 RVASSNMDNPLAIMAPPYENPRESVKKLNALSEVQIDFDHGTTTVGFVYQGGI----------IL 85
            |.:|:..|..:.|.:|.           ..|.:|:..|.       .:.|||:          .:
Zfish     3 RGSSAGFDRHITIFSPE-----------GRLYQVEYAFK-------AINQGGLTSVAVRGKDCAI 49

  Fly    86 CVDSRATSGKLIGSQSIHKVVQVNQYIMGTTAGGAADCTYWDRALTRECRLHELRYKERLPVQSA 150
            .|..:....||:.|.::..:.::.:.|....:|..||.....:....|....:.:|...:||...
Zfish    50 VVTQKKVPDKLLDSSTVTHLFRITENIGCVMSGMTADSRSQVQRARYEAANWKYKYGYEIPVDML 114

  Fly   151 AKYISNVA------AEYKGMGLCMGMMLAGWSPE-GPSLVYVDSNGLRIHGKLFAVGSGAPNALG 208
            .|.|::::      ||.:.:|.|  |::.|...| ||.:...|..|.....|..|.|.....|..
Zfish   115 CKRIADISQVYTQNAEMRPLGCC--MIVIGLDEELGPQVYKCDPAGYYCGFKATAAGVKQTEATS 177

  Fly   209 ILDSDY--RLDLSDNEAYDLA 227
            .|:...  :||.:..:|.:.|
Zfish   178 FLEKKVKKKLDWTFEQAVETA 198

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Prosbeta5R2NP_001286022.1 PTZ00488 46..279 CDD:185666 41/201 (20%)
proteasome_beta_type_5 72..259 CDD:239730 37/175 (21%)
psma6bNP_001002589.1 PRE1 7..245 CDD:223711 43/212 (20%)
proteasome_alpha_type_6 8..220 CDD:239723 43/211 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0638
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.