DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Prosbeta5R2 and Prosalpha4T1

DIOPT Version :9

Sequence 1:NP_001286022.1 Gene:Prosbeta5R2 / 318924 FlyBaseID:FBgn0051742 Length:279 Species:Drosophila melanogaster
Sequence 2:NP_650910.1 Gene:Prosalpha4T1 / 42457 FlyBaseID:FBgn0265606 Length:249 Species:Drosophila melanogaster


Alignment Length:221 Identity:46/221 - (20%)
Similarity:89/221 - (40%) Gaps:40/221 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    34 SSNMDNPLAIMAP-----PYENPRESVKKLNALSEVQIDFDHGTTTVGFVYQGGIILCVDSRATS 93
            ||.....|.|.:|     ..|..:|:|:|             |:|.||......::|.|:..:.|
  Fly     2 SSRYGRALTIFSPDGHLLQVEYAQEAVRK-------------GSTAVGVRGANCVVLGVEKSSVS 53

  Fly    94 GKLIGSQSIHKVVQVNQYIMGTTAGGAADCTYWDRALTRECRLHELRYKERLPVQSAAKYISNVA 158
             ::...:::.|:..:::::....||..||..........||:.|.|.::.::.::...:|::.:.
  Fly    54 -EMQEDRTVRKISMLDRHVALAFAGLTADARILINRGQVECQSHRLNFENQVTLEYITRYLAQLK 117

  Fly   159 AEYKGMGLCMG-------MMLAGWSPEGPS-LVYVDSNGLRIHGKLFAVGSGAPNALGILDSDYR 215
            .:|.   .|.|       .::.|...:|.: |.:.:.:|:....|..|.|..|.......:..| 
  Fly   118 QKYT---QCNGRRPFGISCLIGGIDADGSARLFHTEPSGIFHEYKATATGRWANTVREFFEKAY- 178

  Fly   216 LDLSDNE------AYDLAFLAVYHAT 235
               ||:|      |..||..|:...|
  Fly   179 ---SDHEVTTKCDAIKLAMRALLEVT 201

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Prosbeta5R2NP_001286022.1 PTZ00488 46..279 CDD:185666 42/209 (20%)
proteasome_beta_type_5 72..259 CDD:239730 36/178 (20%)
Prosalpha4T1NP_650910.1 PRK03996 5..239 CDD:235192 44/218 (20%)
proteasome_alpha_type_7 5..213 CDD:239724 44/218 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45440933
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0638
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11599
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.930

Return to query results.
Submit another query.