DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Prosbeta5R2 and psma5

DIOPT Version :9

Sequence 1:NP_001286022.1 Gene:Prosbeta5R2 / 318924 FlyBaseID:FBgn0051742 Length:279 Species:Drosophila melanogaster
Sequence 2:NP_991271.1 Gene:psma5 / 403011 ZFINID:ZDB-GENE-040625-96 Length:241 Species:Danio rerio


Alignment Length:181 Identity:49/181 - (27%)
Similarity:78/181 - (43%) Gaps:38/181 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    71 GTTTVGFVYQGGIILCVDSRATSGKLIGSQSIHKVVQVNQYIMGTTAGGAADC-TYWDRALTREC 134
            |:|.:|.....|:.|.|:.|.|| .|:...||.|:|:::.:|....:|..||. |..|:|.. |.
Zfish    34 GSTAIGIQTSEGVCLAVEKRITS-PLMEPSSIEKIVEIDSHIGCAMSGLIADAKTLIDKARV-ET 96

  Fly   135 RLHELRYKERLPVQSAAKYISNVAAEYK-------------GMGLCMGMMLAGWSPEGPSLVYVD 186
            :.|...|.|.:.|:|..:.:||:|.::.             |:.|..|    |...:||.|.::|
Zfish    97 QNHWFTYNETMTVESVTQAVSNLALQFGEEDADPGAMSRPFGVALLFG----GVDEKGPQLYHMD 157

  Fly   187 SNGLRIHGKLFAVGSGAPNALGILDSDYRLDLSDNEAYDLAFLAVYHATMT 237
            .:|..:.....|:||.:..|...|..                  |||.:||
Zfish   158 PSGTFVQCDARAIGSASEGAQSSLQE------------------VYHKSMT 190

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Prosbeta5R2NP_001286022.1 PTZ00488 46..279 CDD:185666 49/181 (27%)
proteasome_beta_type_5 72..259 CDD:239730 48/180 (27%)
psma5NP_991271.1 proteasome_alpha_type_5 8..220 CDD:239722 49/181 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0638
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.900

Return to query results.
Submit another query.