DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Prosbeta5R2 and Prosbeta2

DIOPT Version :9

Sequence 1:NP_001286022.1 Gene:Prosbeta5R2 / 318924 FlyBaseID:FBgn0051742 Length:279 Species:Drosophila melanogaster
Sequence 2:NP_524076.2 Gene:Prosbeta2 / 39628 FlyBaseID:FBgn0023174 Length:272 Species:Drosophila melanogaster


Alignment Length:219 Identity:57/219 - (26%)
Similarity:103/219 - (47%) Gaps:6/219 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly    48 YENPRESVKKLNALSEVQIDFDHGTTTVGFVYQGGIILCVDSRATSGKLIGSQSIHKVVQVNQYI 112
            ::|.:.:...||...:.......|||.||.:|:.|:||..|:|||.|.::..::..|:..:.:.|
  Fly    16 FDNCKRNATLLNRGFKPPTTTKTGTTIVGIIYKDGVILGADTRATEGPIVSDKNCAKIHYLAKNI 80

  Fly   113 MGTTAGGAADCTYWDRALTRECRLHELRYKERLPVQSAAKYISNVAAEYKGMGLCMGMMLAGWSP 177
            ....||.|||.......::.:..||.|:....:.|.:|...:..:...|:| .:...::|.|...
  Fly    81 YCCGAGTAADTEMTTDLISSQLELHRLQTDREVRVVAANTMLKQMLFRYQG-HISAALVLGGVDK 144

  Fly   178 EGPSLVYVDSNGLRIHGKLFAVGSGAPNALGILDSDYRLDLSDNEAYDLAFLAVYHATMTDIFSG 242
            .||.:..:..:|.........:|||:..|:.:.:|.::.|||:.|...|...|:......|:.||
  Fly   145 TGPHIYSIHPHGSSDKLPYATMGSGSLAAMTVFESRWKPDLSEEEGKKLVRDAIASGVFNDLGSG 209

  Fly   243 GVVRLYHMDQGN---WRN--VANK 261
            ..:.|..:.:|:   .||  :|||
  Fly   210 SNIDLCVIRKGSVEYLRNYELANK 233

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Prosbeta5R2NP_001286022.1 PTZ00488 46..279 CDD:185666 57/219 (26%)
proteasome_beta_type_5 72..259 CDD:239730 50/191 (26%)
Prosbeta2NP_524076.2 PRE1 42..232 CDD:223711 48/190 (25%)
proteasome_beta_type_7 42..228 CDD:239732 47/186 (25%)
Pr_beta_C 232..264 CDD:289249 2/2 (100%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45440972
Domainoid 1 1.000 44 1.000 Domainoid score I729
eggNOG 1 0.900 - - E1_COG0638
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11599
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
54.840

Return to query results.
Submit another query.