DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Prosbeta5R2 and Prosalpha5

DIOPT Version :9

Sequence 1:NP_001286022.1 Gene:Prosbeta5R2 / 318924 FlyBaseID:FBgn0051742 Length:279 Species:Drosophila melanogaster
Sequence 2:NP_477202.2 Gene:Prosalpha5 / 36951 FlyBaseID:FBgn0016697 Length:244 Species:Drosophila melanogaster


Alignment Length:169 Identity:50/169 - (29%)
Similarity:89/169 - (52%) Gaps:14/169 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly    71 GTTTVGFVYQGGIILCVDSRATSGKLIGSQSIHKVVQVNQYIMGTTAGGAADC-TYWDRALTREC 134
            |:|.:|.....|::|.|:.|.||..::.| ::.|:|:|:::|...|:|..||. |..:||.. ||
  Fly    34 GSTAIGICTPEGVVLAVEKRITSPLMVPS-TVEKIVEVDKHIGCATSGLMADARTLIERARV-EC 96

  Fly   135 RLHELRYKERLPVQSAAKYISNVAAEYKGMG-----------LCMGMMLAGWSPEGPSLVYVDSN 188
            :.|...|.||:.::|.|:.:|.:|.::...|           ..:.::.||.....|.|.::|.:
  Fly    97 QNHWFVYNERMSIESCAQAVSTLAIQFGDSGDSDGAAAMSRPFGVAILFAGIEAGQPQLWHMDPS 161

  Fly   189 GLRIHGKLFAVGSGAPNALGILDSDYRLDLSDNEAYDLA 227
            |..:.....|:|||:..|...|...:|.||:.:||.|::
  Fly   162 GTFVRHGAKAIGSGSEGAQQNLQDLFRPDLTLDEAIDIS 200

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Prosbeta5R2NP_001286022.1 PTZ00488 46..279 CDD:185666 50/169 (30%)
proteasome_beta_type_5 72..259 CDD:239730 49/168 (29%)
Prosalpha5NP_477202.2 PRK03996 8..243 CDD:235192 50/169 (30%)
proteasome_alpha_type_5 8..222 CDD:239722 50/169 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45440912
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0638
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11599
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.840

Return to query results.
Submit another query.