DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Prosbeta5R2 and Prosbeta4

DIOPT Version :9

Sequence 1:NP_001286022.1 Gene:Prosbeta5R2 / 318924 FlyBaseID:FBgn0051742 Length:279 Species:Drosophila melanogaster
Sequence 2:NP_001260511.1 Gene:Prosbeta4 / 34999 FlyBaseID:FBgn0032596 Length:201 Species:Drosophila melanogaster


Alignment Length:195 Identity:44/195 - (22%)
Similarity:86/195 - (44%) Gaps:16/195 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly    73 TTVGFVYQGGIILCVDSRATSGKLIGSQSIHKVVQVNQYIMGTTAGGAADCTYWDRALTRECRLH 137
            |.:|......::|..|:......::..:..:|:.:|:..::.:|.|.:.|...:...:::...|:
  Fly     3 TLLGIKGPDFVMLAADTTHARSIIVMKEDQNKIHKVSDSLLISTVGESGDTEQFTEFISKNIALY 67

  Fly   138 ELRYKERLPVQSAAKYISNVAAEY--KGMGLCMGMMLAGWSPE-GPSLVYVD--SNGLRIHGKLF 197
            ::|....|..:.:|.:.....|||  ......:.|.:||:.|. ||.|.::|  :|.|.::  ..
  Fly    68 KMRNGYDLSPRESAHFTRKNLAEYLRSRTPYQVFMFVAGYDPNAGPELTFIDYLANALPVN--YA 130

  Fly   198 AVGSGAPNALGILDSDYRLDLSDNEAYDLAFLAVYHATMTDIFSGGVVRLYHMDQGNWRNVANKD 262
            ..|.||..|..|.|..:..:::..||||     |:...:.:|....||.|.:....    |.:||
  Fly   131 GHGYGAIFASSIYDRYWHPNITQAEAYD-----VFKKCIAEIQKRLVVNLKNFTVA----VVDKD 186

  Fly   263  262
              Fly   187  186

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Prosbeta5R2NP_001286022.1 PTZ00488 46..279 CDD:185666 44/195 (23%)
proteasome_beta_type_5 72..259 CDD:239730 41/190 (22%)
Prosbeta4NP_001260511.1 PRE1 1..194 CDD:223711 44/195 (23%)
proteasome_beta_type_2 1..192 CDD:239727 44/195 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45440942
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0638
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11599
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.840

Return to query results.
Submit another query.