DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Prosbeta5R2 and Prosalpha6T

DIOPT Version :9

Sequence 1:NP_001286022.1 Gene:Prosbeta5R2 / 318924 FlyBaseID:FBgn0051742 Length:279 Species:Drosophila melanogaster
Sequence 2:NP_609623.1 Gene:Prosalpha6T / 34726 FlyBaseID:FBgn0032492 Length:289 Species:Drosophila melanogaster


Alignment Length:178 Identity:40/178 - (22%)
Similarity:70/178 - (39%) Gaps:24/178 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    48 YENPRESVKKLNALSEVQIDFD---HGTTTVGFV---YQGGIILCVDSRATSGKLIGSQSIHKVV 106
            |:|...:......|.:|:...:   .|..|||..   |.....||..|:.|      :....|::
  Fly     6 YDNDTTTWSPQGRLFQVEYAMEAVKQGAATVGLKGTDYAVLAALCRTSKDT------NTLQRKIM 64

  Fly   107 QVNQYIMGTTAGGAAD----CTYWDRALTRECRLHELRYKERLPVQSAAKYISN----VAAEYKG 163
            .|:.::..:.||..||    |.|    :..||..:...|....||:.....:.|    ....|..
  Fly    65 PVDDHVGMSIAGLTADARVVCQY----MRTECMAYRHSYNAEFPVRRLVSNLGNKLQTTTQRYDR 125

  Fly   164 MGLCMGMMLAGWSPEGPSLVYVDSNGLRIHGKLFAVGSGAPNALGILD 211
            ....:|:::||:..:||.:..|......::.|..|:||.:.:|...|:
  Fly   126 RPYGVGLLVAGYDEQGPHIYQVMPTANVLNCKAMAIGSRSQSARTYLE 173

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Prosbeta5R2NP_001286022.1 PTZ00488 46..279 CDD:185666 40/178 (22%)
proteasome_beta_type_5 72..259 CDD:239730 35/151 (23%)
Prosalpha6TNP_609623.1 PRE1 4..233 CDD:223711 40/178 (22%)
proteasome_alpha_type_1 6..215 CDD:239718 40/178 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45440950
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0638
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11599
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.930

Return to query results.
Submit another query.