DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Prosbeta5R2 and Prosalpha6

DIOPT Version :9

Sequence 1:NP_001286022.1 Gene:Prosbeta5R2 / 318924 FlyBaseID:FBgn0051742 Length:279 Species:Drosophila melanogaster
Sequence 2:NP_001285798.1 Gene:Prosalpha6 / 34359 FlyBaseID:FBgn0250843 Length:279 Species:Drosophila melanogaster


Alignment Length:251 Identity:55/251 - (21%)
Similarity:94/251 - (37%) Gaps:46/251 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    38 DNPLAIMAP-----PYENPRESVKKLNALSEVQIDFDHGTTTVGFVYQGGIILCVDSRATSGKLI 97
            |:.:.:.:|     ..|...|:||.             ||.|||...:...:|....:.|| :|.
  Fly     7 DSDVTVWSPQGRLHQVEYAMEAVKL-------------GTATVGLKNKDYAVLVALCKPTS-ELS 57

  Fly    98 GSQSIHKVVQVNQYIMGTTAGGAADCTYWDRALTRECRLHELRYKERLPVQSAAKYISN----VA 158
            .:|  .|::.::.::..:.||..||.....|.|..||..::..|....||......:.|    ..
  Fly    58 DTQ--RKIIPIDDHLGISIAGLTADARVLSRYLRSECLNYKHSYDTTYPVSRLITNLGNKMQTTT 120

  Fly   159 AEYKGMGLCMGMMLAGWSPEGPSLVYVDSNGLRIHGKLFAVGSGAPNALGILDSDYR--LDLSDN 221
            ..|......:|:::||:...||.:..|..:....:.|..::||.:.:|...|:.:..  ||.|.:
  Fly   121 QRYDRRPYGVGLLVAGYDERGPHIYQVTPSATFFNCKANSIGSRSQSARTYLEKNLNKFLDSSKD 185

  Fly   222 EAYDLAFLAVYHATMTDIFSGGVVRLYHMDQGNWRNVANKDCQELHEQYSGVGNQQ 277
            |.......|:.....||            :||       ||..:.....:.||..|
  Fly   186 EIIRHGIRAILGTLPTD------------EQG-------KDAGQYDITVAIVGKDQ 222

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Prosbeta5R2NP_001286022.1 PTZ00488 46..279 CDD:185666 54/243 (22%)
proteasome_beta_type_5 72..259 CDD:239730 43/192 (22%)
Prosalpha6NP_001285798.1 PRE1 4..231 CDD:223711 55/251 (22%)
proteasome_alpha_type_1 6..219 CDD:239718 52/246 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45440951
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0638
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11599
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.840

Return to query results.
Submit another query.