DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Prosbeta5R2 and Prosbeta4R1

DIOPT Version :9

Sequence 1:NP_001286022.1 Gene:Prosbeta5R2 / 318924 FlyBaseID:FBgn0051742 Length:279 Species:Drosophila melanogaster
Sequence 2:NP_608698.2 Gene:Prosbeta4R1 / 33449 FlyBaseID:FBgn0031442 Length:215 Species:Drosophila melanogaster


Alignment Length:172 Identity:38/172 - (22%)
Similarity:72/172 - (41%) Gaps:8/172 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly    83 IILCVDSRATSGKLIGSQSIHKVVQVNQYIMGTTAGGAADCTYWDRALTRECRLHELRYKERLPV 147
            |||..|:......:.....:.|..:::.|.|.:|||...||..:...:.|...|:::.....|.|
  Fly    13 IILASDTMRNKSAMWLDDEVRKTHRISDYCMMSTAGDGGDCLKFSDFILRNMDLYKITNGYDLTV 77

  Fly   148 QSAAKYISNVAAEY--KGMGLCMGMMLAGWS-PEGPSLVYVDSNGLRIHGKLFAVGSGAPNALGI 209
            :.|..:|....:.|  ......:.:::.|:. ..||.|.|:|..|..:..:....|:.......|
  Fly    78 RGAVHFIRRHLSAYLKSDCTFQVSLLVGGYDLTSGPELHYIDYLGNSVPVRYGGHGAAMNFCTPI 142

  Fly   210 LDSDYRLDLSDNEAYDLAFLAVYHATMTDIFSGGVVRLYHMD 251
            |:..|:.|:....|||     |....:.:::...|:.|.::|
  Fly   143 LEEFYKPDMDTQAAYD-----VIKKCVIELYKRFVINLRNID 179

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Prosbeta5R2NP_001286022.1 PTZ00488 46..279 CDD:185666 38/172 (22%)
proteasome_beta_type_5 72..259 CDD:239730 38/172 (22%)
Prosbeta4R1NP_608698.2 PRE1 1..204 CDD:223711 38/172 (22%)
proteasome_beta_type_2 1..193 CDD:239727 38/172 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45440940
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0638
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11599
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.840

Return to query results.
Submit another query.