DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Prosbeta5R2 and psmb8a

DIOPT Version :9

Sequence 1:NP_001286022.1 Gene:Prosbeta5R2 / 318924 FlyBaseID:FBgn0051742 Length:279 Species:Drosophila melanogaster
Sequence 2:NP_571467.3 Gene:psmb8a / 30666 ZFINID:ZDB-GENE-990415-141 Length:271 Species:Danio rerio


Alignment Length:283 Identity:116/283 - (40%)
Similarity:169/283 - (59%) Gaps:30/283 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MALESICGMDKLPFMKSFGYRTSKQTI-------------EEIRVASSNMDNPLAIMAPPYENPR 52
            |||..:.|. |......||:   |||:             :|..|       |:.:      :|.
Zfish     1 MALLDVSGY-KYNSASQFGF---KQTLLDRSNHYSFGTKCQEFAV-------PVGV------DPS 48

  Fly    53 ESVKKLNALSEVQIDFDHGTTTVGFVYQGGIILCVDSRATSGKLIGSQSIHKVVQVNQYIMGTTA 117
            :.:|..:....|.||.:|||||:.|.::.|:|:.|||||::||.|.|:..:||:::|.|::||.:
Zfish    49 KFLKSCSCEDGVCIDLNHGTTTLAFKFRHGVIVAVDSRASAGKYIASKEANKVIEINPYLLGTMS 113

  Fly   118 GGAADCTYWDRALTRECRLHELRYKERLPVQSAAKYISNVAAEYKGMGLCMGMMLAGWSPEGPSL 182
            |.||||.||:|.|.:||||::||.|:|:.|.:|:|.:||:...|:||||.||.|:.||..:||.|
Zfish   114 GSAADCQYWERLLAKECRLYKLRNKQRISVSAASKLLSNMMLGYRGMGLSMGSMICGWDKQGPGL 178

  Fly   183 VYVDSNGLRIHGKLFAVGSGAPNALGILDSDYRLDLSDNEAYDLAFLAVYHATMTDIFSGGVVRL 247
            .|||.||.|:.|::|:.|.|...|.|::||.||.|::..|||:|....:.|||..|.:|||||.|
Zfish   179 YYVDDNGTRLSGRMFSTGCGNSYAYGVVDSGYREDMTVEEAYELGRRGIAHATHRDAYSGGVVNL 243

  Fly   248 YHMDQGNWRNVANKDCQELHEQY 270
            |||.:..|..|..:|..||..:|
Zfish   244 YHMQEDGWIKVCKEDVSELIHRY 266

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Prosbeta5R2NP_001286022.1 PTZ00488 46..279 CDD:185666 103/225 (46%)
proteasome_beta_type_5 72..259 CDD:239730 91/186 (49%)
psmb8aNP_571467.3 PTZ00488 37..266 CDD:185666 105/241 (44%)
proteasome_beta_type_5 68..255 CDD:239730 91/186 (49%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0638
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53702
OrthoDB 1 1.010 - - D396507at33208
OrthoFinder 1 1.000 - - FOG0001305
OrthoInspector 1 1.000 - - mtm6525
orthoMCL 1 0.900 - - OOG6_100897
Panther 1 1.100 - - O PTHR11599
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X647
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
ZFIN 00.000 Not matched by this tool.
1110.790

Return to query results.
Submit another query.