DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Prosbeta5R2 and Psmb5

DIOPT Version :9

Sequence 1:NP_001286022.1 Gene:Prosbeta5R2 / 318924 FlyBaseID:FBgn0051742 Length:279 Species:Drosophila melanogaster
Sequence 2:NP_001099197.2 Gene:Psmb5 / 29425 RGDID:61879 Length:263 Species:Rattus norvegicus


Alignment Length:231 Identity:109/231 - (47%)
Similarity:155/231 - (67%) Gaps:10/231 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly    41 LAIMAPPYENPRESVKKLNALSEVQIDFDHGTTTVGFVYQGGIILCVDSRATSGKLIGSQSIHKV 105
            |::.||.:..|.|.          :|:..|||||:.|.:|.|:|:..|||||:|..|.||::.||
  Rat    39 LSLAAPSWGVPEEP----------RIEMLHGTTTLAFKFQHGVIVAADSRATAGAYIASQTVKKV 93

  Fly   106 VQVNQYIMGTTAGGAADCTYWDRALTRECRLHELRYKERLPVQSAAKYISNVAAEYKGMGLCMGM 170
            :::|.|::||.|||||||::|:|.|.|:||::|||.|||:.|.:|:|.::|:..:||||||.||.
  Rat    94 IEINPYLLGTMAGGAADCSFWERLLARQCRIYELRNKERISVAAASKLLANMVYQYKGMGLSMGT 158

  Fly   171 MLAGWSPEGPSLVYVDSNGLRIHGKLFAVGSGAPNALGILDSDYRLDLSDNEAYDLAFLAVYHAT 235
            |:.||...||.|.||||.|.||.|..|:||||:..|.|::|..|..||...||||||..|:|.||
  Rat   159 MICGWDKRGPGLYYVDSEGNRISGTAFSVGSGSVYAFGVMDRGYSYDLQVEEAYDLARRAIYQAT 223

  Fly   236 MTDIFSGGVVRLYHMDQGNWRNVANKDCQELHEQYS 271
            ..|.:|||.|.|||:.:..|..|::.:..:||::|:
  Rat   224 YRDAYSGGAVNLYHVREDGWIRVSSDNVADLHDKYT 259

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Prosbeta5R2NP_001286022.1 PTZ00488 46..279 CDD:185666 107/226 (47%)
proteasome_beta_type_5 72..259 CDD:239730 97/186 (52%)
Psmb5NP_001099197.2 PTZ00488 29..263 CDD:185666 109/231 (47%)
proteasome_beta_type_5 60..247 CDD:239730 97/186 (52%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0638
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53702
OrthoDB 1 1.010 - - D396507at33208
OrthoFinder 1 1.000 - - FOG0001305
OrthoInspector 1 1.000 - - mtm8992
orthoMCL 1 0.900 - - OOG6_100897
Panther 1 1.100 - - O PTHR11599
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X647
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
1110.790

Return to query results.
Submit another query.