DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Prosbeta5R2 and Psmb11

DIOPT Version :9

Sequence 1:NP_001286022.1 Gene:Prosbeta5R2 / 318924 FlyBaseID:FBgn0051742 Length:279 Species:Drosophila melanogaster
Sequence 2:NP_001381580.1 Gene:Psmb11 / 290206 RGDID:1308773 Length:301 Species:Rattus norvegicus


Alignment Length:203 Identity:84/203 - (41%)
Similarity:124/203 - (61%) Gaps:4/203 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly    70 HGTTTVGFVYQGGIILCVDSRATSGKLIGSQSIHKVVQVNQYIMGTTAGGAADCTYWDRALTREC 134
            |||||:.|.::.|:|...|:|::.|..:...:..||:.|:::::|||:|.:|||..|.|.|.||.
  Rat    48 HGTTTLAFRFRHGVIAAADTRSSCGSYVACPASRKVIPVHRHLLGTTSGTSADCATWYRVLRREL 112

  Fly   135 RLHELRYKERLPVQSAAKYISNVAAEYKGMGLCMGMMLAGWSPEGPSLVYVDSNGLRIHGKLFAV 199
            ||.|||..:...|...||.:|.:.:.|:|:.||:...|.||...||:|.||.|:|..:.|.:|:|
  Rat   113 RLRELREGQLPSVAGTAKLLSAMMSRYRGLDLCVATALCGWDHSGPALFYVYSDGTCLQGDVFSV 177

  Fly   200 GSGAPNALGILDSDYRLDLSDNEAYDLAFLAVYHATMTDIFSGGVVRLYHMDQGNWRNVANKDC- 263
            |||:|.|.|:||..|..|::..|||.||..||.|||..|.:|||.|.|:|:.:..|..::..|. 
  Rat   178 GSGSPYAYGVLDRSYHYDMTVQEAYTLARCAVAHATHRDAYSGGSVDLFHVRESGWEYISRSDAC 242

  Fly   264 ---QELHE 268
               :||.|
  Rat   243 VLYRELQE 250

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Prosbeta5R2NP_001286022.1 PTZ00488 46..279 CDD:185666 84/203 (41%)
proteasome_beta_type_5 72..259 CDD:239730 78/186 (42%)
Psmb11NP_001381580.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D396507at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11599
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X647
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
55.020

Return to query results.
Submit another query.