DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Prosbeta5R2 and pts1

DIOPT Version :9

Sequence 1:NP_001286022.1 Gene:Prosbeta5R2 / 318924 FlyBaseID:FBgn0051742 Length:279 Species:Drosophila melanogaster
Sequence 2:NP_593825.1 Gene:pts1 / 2543623 PomBaseID:SPAC4A8.13c Length:272 Species:Schizosaccharomyces pombe


Alignment Length:246 Identity:115/246 - (46%)
Similarity:155/246 - (63%) Gaps:13/246 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly    34 SSNMDNPLAIMAPP-YEN-------PRESVKKLNALSEVQ-----IDFDHGTTTVGFVYQGGIIL 85
            |:|.|:|..|:... :.|       |:.|:...|...|.:     |..:|||||:.|.||.||::
pombe    11 STNNDDPKKIIEEEGFTNRFDVVPVPQSSLYLRNLTDETKNKHCLIKMNHGTTTLAFRYQHGIVV 75

  Fly    86 CVDSRATSGKLIGSQSIHKVVQVNQYIMGTTAGGAADCTYWDRALTRECRLHELRYKERLPVQSA 150
            ||||||::|.||.||::.||:::|.|::||.|||||||.:|:..|..|||||:||.||.:.|.:|
pombe    76 CVDSRASAGPLIASQTVKKVIEINPYLLGTLAGGAADCQFWETVLGMECRLHQLRNKELISVSAA 140

  Fly   151 AKYISNVAAEYKGMGLCMGMMLAGWSPEGPSLVYVDSNGLRIHGKLFAVGSGAPNALGILDSDYR 215
            :|.:||:...|||.||.||.||||....|.:|.|:||:|.|:.|.||:||||:..|.|:|||.||
pombe   141 SKILSNITYSYKGYGLSMGTMLAGTGKGGTALYYIDSDGTRLKGDLFSVGSGSTFAYGVLDSGYR 205

  Fly   216 LDLSDNEAYDLAFLAVYHATMTDIFSGGVVRLYHMDQGNWRNVANKDCQEL 266
            .|||..||..||..::..||..|.:|||.|.|||:|:..|....|.|...|
pombe   206 WDLSKQEALYLAQRSIVAATHRDAYSGGSVNLYHIDENGWVFHGNFDVDSL 256

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Prosbeta5R2NP_001286022.1 PTZ00488 46..279 CDD:185666 110/234 (47%)
proteasome_beta_type_5 72..259 CDD:239730 99/186 (53%)
pts1NP_593825.1 PRE1 39..262 CDD:223711 108/218 (50%)
proteasome_beta_type_5 62..249 CDD:239730 99/186 (53%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0638
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 258 1.000 Inparanoid score I755
OMA 1 1.010 - - QHG53702
OrthoFinder 1 1.000 - - FOG0001305
OrthoInspector 1 1.000 - - otm47067
orthoMCL 1 0.900 - - OOG6_100897
Panther 1 1.100 - - O PTHR11599
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X647
TreeFam 1 0.960 - -
1110.830

Return to query results.
Submit another query.