DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Prosbeta5R2 and Psmb10

DIOPT Version :9

Sequence 1:NP_001286022.1 Gene:Prosbeta5R2 / 318924 FlyBaseID:FBgn0051742 Length:279 Species:Drosophila melanogaster
Sequence 2:NP_038668.2 Gene:Psmb10 / 19171 MGIID:1096380 Length:273 Species:Mus musculus


Alignment Length:201 Identity:51/201 - (25%)
Similarity:92/201 - (45%) Gaps:5/201 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly    48 YENPRESVKKLNALSEVQIDFDH--GTTTVGFVYQGGIILCVDSRATSGKLIGSQSIHKVVQVNQ 110
            :||.:.:....:.|..:::....  |||..|.|::.|:||..|:|||:..::..:|..|:..:..
Mouse    14 FENCQRNASLEHVLPGLRVPHARKTGTTIAGLVFRDGVILGADTRATNDSVVADKSCEKIHFIAP 78

  Fly   111 YIMGTTAGGAADCTYWDRALTRECRLHELRYKERLPVQSAAKYISNVAAEYKG-MGLCMGMMLAG 174
            .|....||.|||.....|....:..||.|.......|.:..:.:......|:| :|  ..:::.|
Mouse    79 KIYCCGAGVAADTEMTTRMAASKMELHALSTGREPRVATVTRILRQTLFRYQGHVG--ASLVVGG 141

  Fly   175 WSPEGPSLVYVDSNGLRIHGKLFAVGSGAPNALGILDSDYRLDLSDNEAYDLAFLAVYHATMTDI 239
            ....||.|..|..:|........|:|||...|:.:|:..::.:::...|.:|...|:....::|:
Mouse   142 VDLNGPQLYEVHPHGSYSRLPFTALGSGQGAAVALLEDRFQPNMTLEAAQELLVEAITAGILSDL 206

  Fly   240 FSGGVV 245
            .|||.|
Mouse   207 GSGGNV 212

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Prosbeta5R2NP_001286022.1 PTZ00488 46..279 CDD:185666 51/201 (25%)
proteasome_beta_type_5 72..259 CDD:239730 47/175 (27%)
Psmb10NP_038668.2 20S_bact_beta 39..238 CDD:163402 48/176 (27%)
proteasome_beta_type_7 40..226 CDD:239732 47/175 (27%)
Pr_beta_C 232..267 CDD:289249
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0638
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.