Sequence 1: | NP_001286022.1 | Gene: | Prosbeta5R2 / 318924 | FlyBaseID: | FBgn0051742 | Length: | 279 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_038668.2 | Gene: | Psmb10 / 19171 | MGIID: | 1096380 | Length: | 273 | Species: | Mus musculus |
Alignment Length: | 201 | Identity: | 51/201 - (25%) |
---|---|---|---|
Similarity: | 92/201 - (45%) | Gaps: | 5/201 - (2%) |
- Green bases have known domain annotations that are detailed below.
Fly 48 YENPRESVKKLNALSEVQIDFDH--GTTTVGFVYQGGIILCVDSRATSGKLIGSQSIHKVVQVNQ 110
Fly 111 YIMGTTAGGAADCTYWDRALTRECRLHELRYKERLPVQSAAKYISNVAAEYKG-MGLCMGMMLAG 174
Fly 175 WSPEGPSLVYVDSNGLRIHGKLFAVGSGAPNALGILDSDYRLDLSDNEAYDLAFLAVYHATMTDI 239
Fly 240 FSGGVV 245 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
Prosbeta5R2 | NP_001286022.1 | PTZ00488 | 46..279 | CDD:185666 | 51/201 (25%) |
proteasome_beta_type_5 | 72..259 | CDD:239730 | 47/175 (27%) | ||
Psmb10 | NP_038668.2 | 20S_bact_beta | 39..238 | CDD:163402 | 48/176 (27%) |
proteasome_beta_type_7 | 40..226 | CDD:239732 | 47/175 (27%) | ||
Pr_beta_C | 232..267 | CDD:289249 | |||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E1_COG0638 | |
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
2 | 1.810 |