DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Prosbeta5R2 and pbs-5

DIOPT Version :9

Sequence 1:NP_001286022.1 Gene:Prosbeta5R2 / 318924 FlyBaseID:FBgn0051742 Length:279 Species:Drosophila melanogaster
Sequence 2:NP_493558.1 Gene:pbs-5 / 173334 WormBaseID:WBGene00003951 Length:284 Species:Caenorhabditis elegans


Alignment Length:192 Identity:86/192 - (44%)
Similarity:123/192 - (64%) Gaps:7/192 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly    66 IDFDHGTTTVGFVYQ-------GGIILCVDSRATSGKLIGSQSIHKVVQVNQYIMGTTAGGAADC 123
            :.|..||||:.|||:       ||||:.|||||:||:.|.|:|:.|::.:...::.|.|||||||
 Worm    59 MQFRKGTTTLAFVYEPATPADKGGIIVAVDSRASSGEYISSKSVMKILDIGDRMVATMAGGAADC 123

  Fly   124 TYWDRALTRECRLHELRYKERLPVQSAAKYISNVAAEYKGMGLCMGMMLAGWSPEGPSLVYVDSN 188
            .:|.|.:.:.|.|:|||.|..:.|.:|:||.:|....|:|.||.:|.|:||:..:||.:..|||.
 Worm   124 QFWTRIVAKYCTLYELREKTSITVSAASKYFANTLYGYRGQGLSVGSMVAGYDKKGPQIFKVDSE 188

  Fly   189 GLRIHGKLFAVGSGAPNALGILDSDYRLDLSDNEAYDLAFLAVYHATMTDIFSGGVVRLYHM 250
            |.|...|:.:||||:.||.||||:.|:..::|:||..|...|:.|||..|..||||..|.|:
 Worm   189 GDRCQLKVCSVGSGSLNAYGILDNHYKPKMTDDEARKLGLRAIMHATYRDSGSGGVCNLCHI 250

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Prosbeta5R2NP_001286022.1 PTZ00488 46..279 CDD:185666 86/192 (45%)
proteasome_beta_type_5 72..259 CDD:239730 84/186 (45%)
pbs-5NP_493558.1 Ntn_hydrolase 65..252 CDD:320988 84/186 (45%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C160159082
Domainoid 1 1.000 200 1.000 Domainoid score I1766
eggNOG 1 0.900 - - E1_COG0638
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 210 1.000 Inparanoid score I2376
Isobase 1 0.950 - 0 Normalized mean entropy S454
OMA 1 1.010 - - QHG53702
OrthoDB 1 1.010 - - D396507at33208
OrthoFinder 1 1.000 - - FOG0001305
OrthoInspector 1 1.000 - - otm14414
orthoMCL 1 0.900 - - OOG6_100897
Panther 1 1.100 - - O PTHR11599
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X647
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
1413.760

Return to query results.
Submit another query.