DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Prosbeta5R2 and pbs-2

DIOPT Version :9

Sequence 1:NP_001286022.1 Gene:Prosbeta5R2 / 318924 FlyBaseID:FBgn0051742 Length:279 Species:Drosophila melanogaster
Sequence 2:NP_493271.1 Gene:pbs-2 / 173168 WormBaseID:WBGene00003948 Length:277 Species:Caenorhabditis elegans


Alignment Length:179 Identity:55/179 - (30%)
Similarity:89/179 - (49%) Gaps:5/179 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly    71 GTTTVGFVYQGGIILCVDSRATSGKLIGSQSIHKVVQVNQYIMGTTAGGAADCTYWDRALTRECR 135
            |||.|...::||:::..|||||:|.:|..:...||.::.:.|....||.|||.....:.|:...|
 Worm    46 GTTIVAVAFKGGLVMGADSRATAGNIIADKHCEKVHKLTESIYACGAGTAADLDQVTKMLSGNLR 110

  Fly   136 LHELRYKERLPVQSAAKYISNVAAEYKGMGLCMG--MMLAGWSPEGPSLVYVDSNGLRIHGKLFA 198
            |.||....:..|.:|.:........|:|.   :|  :::.|..|.||.|....:||..:.....|
 Worm   111 LLELNTGRKARVITALRQAKQHLFNYQGY---IGAYLLIGGVDPTGPHLYMCSANGTTMAFPFTA 172

  Fly   199 VGSGAPNALGILDSDYRLDLSDNEAYDLAFLAVYHATMTDIFSGGVVRL 247
            .|||:..|:.||:.|:::|::.:||..|...|:......|..||..:.|
 Worm   173 QGSGSYAAITILERDFKVDMTKDEAEKLVQRALEAGMHGDNASGNSLNL 221

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Prosbeta5R2NP_001286022.1 PTZ00488 46..279 CDD:185666 55/179 (31%)
proteasome_beta_type_5 72..259 CDD:239730 54/178 (30%)
pbs-2NP_493271.1 PRE1 43..228 CDD:223711 55/179 (31%)
proteasome_beta_type_7 47..235 CDD:239732 54/178 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0638
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.