DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Prosbeta5R2 and psmb11

DIOPT Version :9

Sequence 1:NP_001286022.1 Gene:Prosbeta5R2 / 318924 FlyBaseID:FBgn0051742 Length:279 Species:Drosophila melanogaster
Sequence 2:XP_002941563.2 Gene:psmb11 / 100489702 XenbaseID:XB-GENE-6046332 Length:277 Species:Xenopus tropicalis


Alignment Length:277 Identity:94/277 - (33%)
Similarity:147/277 - (53%) Gaps:27/277 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MALESICGMDKLPFMKSFGYRTSKQTIEE-------IRVASSNMDNPLAIMAPPYENPRESVKKL 58
            |||:|:|..|         ..:||:.:..       ::||||          |....|:.||...
 Frog     1 MALQSVCSWD---------LTSSKELMPRNLCPFPGLKVASS----------PHVFLPQHSVSAS 46

  Fly    59 NALSEVQIDFDHGTTTVGFVYQGGIILCVDSRATSGKLIGSQSIHKVVQVNQYIMGTTAGGAADC 123
            :...|......|||||:.|:|.||::...|:|:::|.|:.|....|...::.:::.||:|.:|||
 Frog    47 SRHPEGPPPPAHGTTTLAFIYSGGVVAATDTRSSAGHLVCSPDSRKATLIHSHLLATTSGSSADC 111

  Fly   124 TYWDRALTRECRLHELRYKERLPVQSAAKYISNVAAEYKGMGLCMGMMLAGWSPEGPSLVYVDSN 188
            ..:.|||.||||:::||......|:.|||.:|.:...::||.:|....|.||...||.:.||.::
 Frog   112 QLFGRALARECRIYQLRNGYMPSVRGAAKMLSMIMMPFRGMKVCAAFTLCGWDRNGPCICYVYND 176

  Fly   189 GLRI-HGKLFAVGSGAPNALGILDSDYRLDLSDNEAYDLAFLAVYHATMTDIFSGGVVRLYHMDQ 252
            |.|| ...:.:||||:|.|..|:|..||:.:.:.||..||..||.||...|.:|||.|.:|.:.:
 Frog   177 GTRISSSNVISVGSGSPYAYSIIDDGYRVGMGEEEARKLARRAVCHAGRRDAYSGGSVDVYWIRE 241

  Fly   253 GNWRNVANKDCQELHEQ 269
            |.....|.:|..:|:|:
 Frog   242 GGCERDAREDLVQLYEK 258

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Prosbeta5R2NP_001286022.1 PTZ00488 46..279 CDD:185666 82/225 (36%)
proteasome_beta_type_5 72..259 CDD:239730 71/187 (38%)
psmb11XP_002941563.2 Ntn_hydrolase 60..246 CDD:412394 71/185 (38%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D396507at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.