DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Prosbeta5R2 and LOC100485711

DIOPT Version :9

Sequence 1:NP_001286022.1 Gene:Prosbeta5R2 / 318924 FlyBaseID:FBgn0051742 Length:279 Species:Drosophila melanogaster
Sequence 2:XP_031747268.1 Gene:LOC100485711 / 100485711 -ID:- Length:271 Species:Xenopus tropicalis


Alignment Length:280 Identity:114/280 - (40%)
Similarity:165/280 - (58%) Gaps:23/280 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MALESICGMD-----KLPFMKSFGYRTSKQTIEEIRVASSNMDNPLAIMAPPYENPRESVKKLNA 60
            |||.::||..     ::|.   :|.:.|..:      ....::|...:  ||...|   .|.|:.
 Frog     1 MALLNLCGPPQNQEWRMPL---YGGKISPTS------PYKALENEFVV--PPGIQP---AKFLHY 51

  Fly    61 LSE----VQIDFDHGTTTVGFVYQGGIILCVDSRATSGKLIGSQSIHKVVQVNQYIMGTTAGGAA 121
            |.|    |:|:..|||||:.|.::.|:|:.|||||::|..|.|...:||:::|.|::||.:|.||
 Frog    52 LREGMDGVKIEPWHGTTTLAFKFKHGVIVAVDSRASAGSYIASLKANKVIEINPYLLGTMSGSAA 116

  Fly   122 DCTYWDRALTRECRLHELRYKERLPVQSAAKYISNVAAEYKGMGLCMGMMLAGWSPEGPSLVYVD 186
            ||.||:|.|.:||||::||...|:.|.:|:|.:.|:..:|:|.||.||.|:.||...||.|.|||
 Frog   117 DCQYWERLLAKECRLYQLRNNSRISVSAASKLLCNMMLQYRGSGLSMGSMICGWDKMGPGLYYVD 181

  Fly   187 SNGLRIHGKLFAVGSGAPNALGILDSDYRLDLSDNEAYDLAFLAVYHATMTDIFSGGVVRLYHMD 251
            .||.|:.|.:|:.|||...|.|::||.||.||:..|||||...||.:|...|.:|||||.:|||.
 Frog   182 DNGTRLSGDIFSTGSGNSYAYGVMDSGYRYDLTPVEAYDLGRRAVSYAAHRDNYSGGVVNMYHMK 246

  Fly   252 QGNWRNVANKDCQELHEQYS 271
            :..|..|...|..:|..:||
 Frog   247 EDGWVKVGEFDVGDLLYKYS 266

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Prosbeta5R2NP_001286022.1 PTZ00488 46..279 CDD:185666 105/230 (46%)
proteasome_beta_type_5 72..259 CDD:239730 89/186 (48%)
LOC100485711XP_031747268.1 proteasome_beta_type_5 67..254 CDD:239730 89/186 (48%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D396507at33208
OrthoFinder 1 1.000 - - FOG0001305
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X647
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
33.010

Return to query results.
Submit another query.