DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31735 and spata17

DIOPT Version :9

Sequence 1:NP_723937.3 Gene:CG31735 / 318922 FlyBaseID:FBgn0051735 Length:312 Species:Drosophila melanogaster
Sequence 2:NP_001135736.1 Gene:spata17 / 799739 ZFINID:ZDB-GENE-111214-1 Length:357 Species:Danio rerio


Alignment Length:269 Identity:62/269 - (23%)
Similarity:111/269 - (41%) Gaps:61/269 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 AARRIQSFWRGYRVRKLLHLRWQSAIAIQRWWRGFRTRHILYEKVERRLQGIIHEHFHRAAIRIQ 68
            ||.||||::||.:||..:....::||.||:.||||..|.:..::|:.....:....:::.|::||
Zfish    36 AAVRIQSWFRGCQVRAYIRHLHKNAILIQKTWRGFTARALFRQRVKTAYFIMKMNFYNKMAVKIQ 100

  Fly    69 ALFRGWWVRKFIHDV------------RNLH-----------------RMQCTAAEDLINCIIHE 104
            ..:||::|||::|:.            :|.|                 |:.....|.........
Zfish   101 QRWRGFYVRKYVHNYYARKRYLEGLTRKNEHIRRDLEEFAEFQRRERERIALEKEEQEKKIQAQR 165

  Fly   105 MHHIKKTDSIPGVISLRNSVCRSKVEKLLTTMIFRFHNGRVLSMVANRMSQKEEYRRHF------ 163
            :|.:..|...|||.   ||..|::.:::...:       |.:..:..|.:.||....:.      
Zfish   166 LHFLLSTKQCPGVF---NSPFRAEPDEMELRL-------RTVKPLLVRSAPKERKTPNITPDLSS 220

  Fly   164 ----RDARFVTHIPYSGPNFDGLCYVREDDHIVLKEVPTDLRYSEIVTEYEES----QLHEH--- 217
                |:.....|....|| |.....|::..:   :.:...||.:..:|..||:    :|||.   
Zfish   221 VMPNRERLPPIHKKTQGP-FRPALEVQQQRY---RPLEPSLRVATSITALEEAREELKLHEWRTR 281

  Fly   218 -LRETHLRF 225
             :.:|.|.|
Zfish   282 VIDQTFLPF 290

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31735NP_723937.3 COG5022 <4..>79 CDD:227355 27/74 (36%)
spata17NP_001135736.1 COG5022 <87..>161 CDD:227355 13/73 (18%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170592586
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_2CGXK
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - oto39381
orthoMCL 1 0.900 - - OOG6_104978
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X6126
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
ZFIN 00.000 Not matched by this tool.
76.600

Return to query results.
Submit another query.