DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31735 and Spata17

DIOPT Version :9

Sequence 1:NP_723937.3 Gene:CG31735 / 318922 FlyBaseID:FBgn0051735 Length:312 Species:Drosophila melanogaster
Sequence 2:NP_083124.1 Gene:Spata17 / 74717 MGIID:1921967 Length:379 Species:Mus musculus


Alignment Length:342 Identity:67/342 - (19%)
Similarity:104/342 - (30%) Gaps:110/342 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 AARRIQSFWRGYRVRKLL-HLRWQSAIAIQRWWRGFRTRHILYEKVERRLQGIIHEHFHRAAIRI 67
            ||..|||::||.:||..: ||. :....||:|||.:..|......||.....:....::..|:||
Mouse    51 AAVMIQSWFRGCQVRAYMRHLN-RVVTIIQKWWRSYLGRKFYQLVVEAAYYTMKMNLYNEMAVRI 114

  Fly    68 QALFRGWWVRKFIHDVRNLHRMQCTAAE--DLINCIIHE-------------------------- 104
            |..:||:.:||:..:...|.......:|  |.|...:.|                          
Mouse   115 QRRWRGFRIRKYCFNYYYLKEYLRAVSETNDAIREALEEFAEMKEREERKVLLEREEKQKDYQAR 179

  Fly   105 -MHHIKKTDSIPGVISL---------------------------RNSVCRSKVEKLLTTMIFRFH 141
             ||::..|..|.|:.:.                           :....:|....|..|.:..|.
Mouse   180 KMHYLLSTKQISGIYNSPFREHPDPWELRLQKAKPLGHQKYTAEKGKTSQSPSNWLACTSVHSFP 244

  Fly   142 NGRVLSMVANRMSQKEEYRRHFRDARFVTHIPYSGPNFDGLCYVREDDHIVLKEVPTDLRYSEIV 206
            ....|..::.:..|..     |||...|....|                   |.:...||.:|.:
Mouse   245 QSESLPPISRKRCQGP-----FRDINEVLEQRY-------------------KPLEPTLRVAEPI 285

  Fly   207 TEYEESQLHEHLRETHLRFDLRKLQRQID---HINYQELHLKRKFCADVIDRMRKWTIWDSISAN 268
                     .|||.....|...:..|.:.   .:.:...|.|.|:                |...
Mouse   286 ---------NHLRLAREAFKQEERMRNVQDKMFLPFSSYHKKEKY----------------IPMI 325

  Fly   269 HKQNIYESRKNTQVFFR 285
            |..:.|.|....|..||
Mouse   326 HSSSAYNSDSYGQKHFR 342

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31735NP_723937.3 COG5022 <4..>79 CDD:227355 26/75 (35%)
Spata17NP_083124.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167847347
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_2CGXK
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_104978
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X6126
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
65.600

Return to query results.
Submit another query.