DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31735 and Spata17

DIOPT Version :9

Sequence 1:NP_723937.3 Gene:CG31735 / 318922 FlyBaseID:FBgn0051735 Length:312 Species:Drosophila melanogaster
Sequence 2:XP_006250511.1 Gene:Spata17 / 498305 RGDID:1565282 Length:363 Species:Rattus norvegicus


Alignment Length:321 Identity:68/321 - (21%)
Similarity:106/321 - (33%) Gaps:118/321 - (36%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 AARRIQSFWRGYRVRKLL-HLRWQSAIAIQRWWRGFRTRHILYEKVERRLQGIIHEHFHRAAIRI 67
            ||..|||::||.:||..: ||. :....||:|||.:..|......||.....:....::..|:||
  Rat    35 AAVAIQSWFRGCQVRAYIRHLN-RVVTIIQKWWRSYLGRKYYQLIVEAAYYTMKMNLYNEMAVRI 98

  Fly    68 QALFRGWWVRKFIHDVRNLHRMQCTAAE--DLINCIIHEM------------------------- 105
            |..:||:.:||:..:...|.......:|  |.|...:.|.                         
  Rat    99 QRRWRGFRIRKYCFNYYYLKEYLRAVSETNDAIREALEEFAEMKEREERKILLELEEKQKDYQAR 163

  Fly   106 --HHIKKTDSIPGVIS----------------------LRNSVCRSKVEKLLTTMI--------- 137
              |::..|..|.||.:                      .:.|..:||....|::.:         
  Rat   164 KTHYLLSTKQISGVYNSPFREHPDPWEVRLQKAKPLEHRKGSAMKSKTAHSLSSWLACTSARSFP 228

  Fly   138 ----------------FRFHNGRVLSM-------------------VANRMSQKEEYRRHFRDAR 167
                            ||..| .||..                   ||....::||..|:.:|..
  Rat   229 RSASLPPIDRKRCQGPFRDIN-EVLEQRYKPLEPTLRVSEPIDHLHVAREAFKQEERMRNVQDKM 292

  Fly   168 FV---------THIP-------YSGPNFDGLCYVREDD---HIVLKEVPTDLRYSEIVTEY 209
            |:         |:||       |..|:: |..|.|..|   .|..|:..|.|...|:.::|
  Rat   293 FLPFSSYHKKETYIPMIHTLSTYDSPSY-GQKYFRCQDPKKWISDKDFQTVLPSFELFSKY 352

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31735NP_723937.3 COG5022 <4..>79 CDD:227355 26/75 (35%)
Spata17XP_006250511.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166350900
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_2CGXK
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_104978
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X6126
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.730

Return to query results.
Submit another query.