DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31735 and CG18063

DIOPT Version :9

Sequence 1:NP_723937.3 Gene:CG31735 / 318922 FlyBaseID:FBgn0051735 Length:312 Species:Drosophila melanogaster
Sequence 2:NP_001162988.1 Gene:CG18063 / 34943 FlyBaseID:FBgn0028856 Length:372 Species:Drosophila melanogaster


Alignment Length:268 Identity:81/268 - (30%)
Similarity:134/268 - (50%) Gaps:20/268 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 FIAARRIQSFWRGYRVRKLLHLRWQSAIAIQRWWRGFRTRHILYEKVERRLQGIIHEHFHRAAIR 66
            |.|||.||.:..|:.||:......:|||.||:|||.|..:..|....|..||..:..|:.::|..
  Fly    57 FKAARTIQRYIHGWLVRENFRKLQKSAIIIQKWWRRFEAQKNLLYVAESALQSAVLAHYDKSATL 121

  Fly    67 IQALFRGWWVRKFIHDVRNLHRMQCTAAEDLINCIIHEMHHIKKTDSIPGVISLR-NSVCRSKVE 130
            ||.|:||||.||.|.|:..|..:|...|:|||:.:::.:|..|.::.:||:.::| :|:|...:|
  Fly   122 IQTLYRGWWSRKHIFDLTMLKSVQIMLAKDLIHSLVNYLHATKNSEMLPGIYTIRDSSICLETLE 186

  Fly   131 KLLTTMIFRFHNGRVLSMVANRMSQKEEYRRHFRDARFVTHIPYSGPNFDGLCYVREDDHIVLKE 195
            :|:.|..|||:|......:...:|...:.|:.|....:.|.:||.|.|..|.|..|::..:.|. 
  Fly   187 ELMATFGFRFYNANACYKMKETLSMVAQSRKTFTATSYFTDVPYPGFNDRGFCGPRQNSAMTLN- 250

  Fly   196 VPTDLRYSEIVTEYEESQLHEHLRETH-LRFDLRKLQRQIDHI---NYQELHLKR-----KFCAD 251
             ..|..:.|::        |..|..:. :.....||:::|.:|   |...:.:||     .|...
  Fly   251 -AKDPEHYELI--------HIFLSGSRKIGMTTAKLEQKIANIAEENRLNMFIKRDNKKKSFIKR 306

  Fly   252 VIDRMRKW 259
            :...|:.|
  Fly   307 IYLDMKNW 314

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31735NP_723937.3 COG5022 <4..>79 CDD:227355 31/74 (42%)
CG18063NP_001162988.1 IQ 78..99 CDD:197470 9/20 (45%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45464971
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_2CGXK
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0014388
OrthoInspector 1 1.000 - - otm47562
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
54.740

Return to query results.
Submit another query.